CINXE.COM
TPA
<!DOCTYPE html> <html lang="en"> <head> <meta charset="UTF-8" /> <meta property="og:title" content="TPA" /> <meta property="og:url" content="https://www.ddbj.nig.ac.jp/ddbj/tpa-e.html" /> <meta property="og:description" content="[Caution] From January 2025 TPA-Exp and TPA-Inf submission types will no longer ..." /> <meta property6="og:image" content="/images/thumbnail/logo_ddbj_fb.png" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <title>TPA</title> <script async src="https://www.google-analytics.com/analytics.js"></script> <script src="https://code.jquery.com/jquery-3.5.0.js" integrity="sha256-r/AaFHrszJtwpe+tHyNi/XCfMxYpbsRg2Uqn0x3s2zc=" crossorigin="anonymous"></script> <script src="https://cdnjs.cloudflare.com/ajax/libs/jquery.hoverintent/1.10.1/jquery.hoverIntent.min.js" integrity="sha512-gx3WTM6qxahpOC/hBNUvkdZARQ2ObXSp/m+jmsEN8ZNJPymj8/Jamf8+/3kJQY1RZA2DR+KQfT+b3JEB0r9YRg==" crossorigin="anonymous"></script> <script src="https://cdnjs.cloudflare.com/ajax/libs/spin.js/4.1.0/spin.min.js" integrity="sha512-CbohqWjAgarTqRHcX1MbwkF2pujwbsCee1PABpnBWC+VqSldvlNEEI5+4OSsR/HbFQOFFpwY2YvZZNjBMxNnXg==" crossorigin="anonymous"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/jquery.colorbox/1.6.4/jquery.colorbox-min.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/jquery-deparam/0.5.3/jquery-deparam.min.js"></script> <script type="text/javascript" src="https://www.ddbj.nig.ac.jp/assets/js/jquery.trace.js"></script> <script type="text/javascript" src="https://www.ddbj.nig.ac.jp/assets/js/jquery.json_search.js"></script> <link rel="icon" href="https://www.ddbj.nig.ac.jp/assets/images/favicon_ddbj.ico"> <link rel="stylesheet" href="https://www.ddbj.nig.ac.jp/assets/css/colorbox.css" /> <link rel="stylesheet" href="https://www.ddbj.nig.ac.jp/assets/css/main.css" /> <link rel="alternate" type="application/rss+xml" title="My Site RSS" href="/feed.xml" /> <script src="https://www.ddbj.nig.ac.jp/assets/js/main.js"></script> </head> <body data-category="ddbj"> <script src="https://www.ddbj.nig.ac.jp/assets/js/ddbj_common_framework.js" id="DDBJ_common_framework" style="display: block; height: 40px;" data-bottom-menu="true" data-ddbj-home-page="true" data-search="true" ></script> <section class="top-news-view"> <div class="inner"> <ul> <li class="item"> <a href="https://www.ddbj.nig.ac.jp/news/en/2024-10-22-e">On Cyber Threats against DDBJ, a node of the International Nucleotide Sequence Database Collaboration</a> </li> <li class="item"> <a href="https://www.ddbj.nig.ac.jp/news/en/2024-11-22-e">(27st November 9:00-November 28th 12:00)Announcement of D-way/MSS suspension</a> </li> </ul> </div> </section> <div id="primary"> <header id="PageHeader"> <div class="inner"> <div class="page-title"> <p class="title -normal">DDBJ Annotated/Assembled Sequences</p> </div> <nav class="tab-menu-view"> <ul class="tabmenucontainer"> <li class=""> <a href="/ddbj/index-e.html">Home</a> </li> <li class=" -haschild"> <a href="/ddbj/submission-e.html">Submission</a> <ul> <li> <a href="/ddbj/submission-e.html">Before Submission</a> </li> <li> <a href="/ddbj/web-submission-e.html">Web submission</a> </li> <li> <a href="/ddbj/mss-e.html">Mass Submission</a> </li> <li> <a href="/ddbj/update-e.html">Data Update</a> </li> </ul> </li> <li class=" -haschild"> <a href="http://ddbj.nig.ac.jp/arsa/?lang=en">Search</a> <ul> <li> <a href="http://getentry.ddbj.nig.ac.jp/top-e.html">getentry</a> </li> <li> <a href="http://ddbj.nig.ac.jp/arsa/?lang=en">ARSA</a> </li> </ul> </li> <li class=" -haschild"> <a href="/ddbj/flat-file-e.html">Flat file</a> <ul> <li> <a href="/ddbj/feature-table-e.html">Feature Table</a> </li> <li> <a href="/ddbj/features-e.html">Feature key</a> </li> <li> <a href="/ddbj/qualifiers-e.html">Qualifier key</a> </li> <li> <a href="/ddbj/sequence-e.html">Nucleotide Sequences</a> </li> <li> <a href="/ddbj/organism-e.html">Organism qualifier</a> </li> <li> <a href="/ddbj/identifiers-e.html">Identifiers</a> </li> <li> <a href="/ddbj/location-e.html">Description of Location</a> </li> <li> <a href="/ddbj/cds-e.html">Protein Coding Sequence</a> </li> <li> <a href="/ddbj/geneticcode-e.html">The Genetic Codes</a> </li> <li> <a href="/ddbj/code-e.html">Codes Used in Sequence Description</a> </li> <li> <a href="/ddbj/example-e.html">Description Examples of Sequence Data</a> </li> </ul> </li> <li class=" -haschild -current"> <a href="/ddbj/data-categories-e.html">Data categories</a> <ul> <li> <a href="/ddbj/genome-e.html">Data Submission from Genome Project</a> </li> <li> <a href="/ddbj/pseudohaplotype-e.html">Pseudohaplotype</a> </li> <li> <a href="/ddbj/wgs-e.html">WGS</a> </li> <li> <a href="/ddbj/finished_level_genome-e.html">Finished level genomic sequences</a> </li> <li> <a href="/ddbj/metagenome-assembly-e.html">Metagenome Assembly</a> </li> <li> <a href="/ddbj/single-amplified-genome-e.html">Single amplified genome</a> </li> <li> <a href="/ddbj/htg-e.html">HTG</a> </li> <li> <a href="/ddbj/environmental-e.html">Environmental sample</a> </li> <li> <a href="/ddbj/env-e.html">ENV</a> </li> <li> <a href="/ddbj/tls-e.html">TLS</a> </li> <li> <a href="/ddbj/transcriptome-e.html">Data Submission from Transcriptome Project</a> </li> <li> <a href="/ddbj/tsa-e.html">TSA</a> </li> <li> <a href="/ddbj/est-e.html">EST</a> </li> <li> <a href="/ddbj/htc-e.html">HTC</a> </li> <li> <a href="/ddbj/tpa-e.html">Third Party Data (TPA)</a> </li> </ul> </li> <li class=""> <a href="/faq/en/index-e.html?tag=ddbj">FAQ</a> </li> <li class=" -haschild"> <a href="/ddbj/index-e.html">Other</a> <ul> <li> <a href="/ddbj/patent-data-e.html">Patent</a> </li> <li> <a href="/ddbj/mga-e.html">MGA</a> </li> </ul> </li> </ul> </nav> </div> </header> <section id="NavigationAndMainView"> <div class="inner"> <div class="subview"> <nav id="TableOfContents" class="internal-link"> </nav> </div> <section id="MainContentView" class="mainview"> <header class="header"> <nav class="breadcrumb-view"> <ul> <li> <a href="https://www.ddbj.nig.ac.jp/index-e.html">Home</a> </li> <li> <a href="https://www.ddbj.nig.ac.jp/ddbj/index-e.html">ddbj</a> </li> <li><a>TPA</a></li> </ul> </nav> <h1 class="title">TPA</h1> </header> <main class="md-content"> <p><span class="red">[Caution]</span> <a href="/news/en/2024-09-05-e.html">From January 2025 TPA-Exp and TPA-Inf submission types will no longer be accepted as new submissions</a></p> <p>TPA (Third Party Data) is a nucleotide sequence data collection in which each primary is obtained by assembling <a href="#definition_of_primary">primary entries</a> publicized from with additional feature annotation(s) determined by experimental or inferential methods by TPA submitter. <br /> Those assemblies include two cases; one or more <a href="#definition_of_primary">primary entries</a> are used and newly determined sequence is contained. TPA sequence data should be submitted to DDBJ/EMBL-Bank/GenBank as a part of the process to publish biological research for primary nucleotide sequences.</p> <p>Reference Literature: <a href="https://www.liebertpub.com/doi/abs/10.1089/omi.2006.10.105">Cochrane,G. et al. (2006) OMICS,10(2): 105-113</a></p> <dl> <dt>Definition of primary entry for TPA <a name="definition_of_primary"></a></dt> <dd>Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the DDBJ/EMBL-Bank/GenBank databases.Each primary entry must be identified in the TPA entry.</dd> <dd> <p>Primary entries are sometimes not yet publicized at the submission of TPA sequence.However, the primary entries must be publicized when TPA sequence is opened to the public.</p> </dd> <dt>Acceptable TPA sequence data</dt> <dd>In order to draw a distinction between annotation supported by wet-lab. experimental evidence and inferred annotation, the TPA dataset is divided into TPA:experimental and TPA:inferential.<br /> Please refer to <a href="/ddbj/tpa-table-e.html">the detailed list of TPA rule</a>.</dd> <dd> <table> <tbody> <tr> <td><a href="/ddbj/tpa-table-e.html#exp">TPA:experimental</a></td> <td>describes records that include functional annotation derived at least in part from peer-reviewed wet-lab experimental investigation.</td> </tr> <tr> <td><a href="/ddbj/tpa-table-e.html#inf">TPA:inferential</a></td> <td>describes records that include functional annotation derived from peer-reviewed bioinformatic investigation.</td> </tr> <tr> <td><a href="/ddbj/tpa-table-e.html#ass">TPA:assembly</a></td> <td>describes records reporting assembly or reassembly, for which the generation, whether it is purely informatic or informed by experimentation, has been subject to peer review. Annotation may or may not be available and does not require to be part of the peer review for this TPA class.</td> </tr> <tr> <td><a href="/ddbj/tpa-table-e.html#spe">TPA:specialist_db</a></td> <td>describes records whose sequences are submitted from an existing authoritative public database that is built using INSDC sequence data and is described in an accepted peer-reviewed publication. The existing database is therefore recognized to be comprehensive, to have added value, and to be maintained long term.</td> </tr> </tbody> </table> </dd> </dl> <p>[Note]Until 2005, the only entries which were supported by biological (wet-lab.) experiment were accepted in TPA. Since 2006, entries which are not supported by wet-lab. experiment have been included into TPA when the entry meets the requirements of <a href="/ddbj/tpa-table-e.html">TPA Submission Guidelines</a>.</p> <dl> <dt>The following cases are NOT acceptable in TPA</dt> <dd> <ul> <li>Annotation of repeat (and no other) features.</li> <li>Annotation that has arisen from an automated tool, such as GeneMark,tRNA scan or ORF finder, where no further evidence, experimental or otherwise, is presented for the annotation. The annotation in these cases has not been the subject of the peer review of the publication.</li> <li>A record representing a completely sequenced genome including only features that have not been assigned gene symbols or product identifiers, for which none has wet laboratory experimental evidence.</li> </ul> <p><a href="/ddbj/tpa-table-e.html#nottpa">Refer also this page</a></p> </dd> <dt>Notes on the TPA submission</dt> <dd> <ul> <li>Consensus sequences obtained from multiple species are not acceptable.</li> <li>The sequences of <a href="#definition_of_primary">primary entries</a> used to assemble a TPA sequence are required to be submitted to INSDC as ‘primary data (i.e. not TPA)’ or Trace Archive. If your TPA sequence contains a region that can not be obtained from INSDC or Trace Archive, but has been experimentally determined by yourself, at first, you have to submit it to DDBJ or Trace Archive.</li> <li>For publicizing of TPA sequence, the evidence which support the sequence or annotation must be shown in a paper of a peer-reviewed journal.</li> <li>To describe the correspondence of sequence regions between TPA and primary entries, both locations should be prepared.</li> </ul> </dd> <dt>The sequence alignment rule between TPA and primary entries</dt> <dd> <ul> <li>There cannot be stretches of more than 50bp which are unaccounted for by any contributing entry.</li> <li>A TPA sequence may not differ from the primary sequence(s) used to build/assemble it and any unmatched sections by greater than 5%. (This includes the overall length and individual primary accession)</li> <li>This 5% (or less) difference will include sections of TPA sequence not covered by any primary, and it will include any differences between the TPA sequence and the primaries used, such as insertions, deletions, and substitutions.</li> <li>These rules are based on length and similarity.</li> </ul> </dd> <dt>Aspects of TPA on DDBJ flat file</dt> <dd> <ul> <li><a href="#LocusA">LOCUS</a> line provides the taxonomic division except CON and TSA cases.</li> <li>Either of “TPA_exp:” (for TPA:experimental) or “TPA_inf:” (for TPA:inferential) is shown at the beginning of <a href="#DefinitionA">DEFINITION</a> line.</li> <li>Either set of the following values is indicated in <a href="#KeywordsA">KEYWORDS</a> line.<br /><table><tbody><tr><td>for <a href="/ddbj/tpa-table-e.html#exp">TPA:experimental</a></td><td>Third Party Data; TPA; TPA:experimental.</td></tr><tr><td>for <a href="/ddbj/tpa-table-e.html#inf">TPA:inferential</a></td><td>Third Party Data; TPA; TPA:inferential.</td></tr><tr><td>for <a href="/ddbj/tpa-table-e.html#ass">TPA:assembly</a></td><td class="second">Third Party Data; TPA; TPA:assembly.</td></tr><tr><td>for <a href="/ddbj/tpa-table-e.html#spe">TPA:specialist_db</a></td><td>Third Party Data; TPA; TPA:specialist_db.</td></tr></tbody></table></li> <li><a href="#PrimaryA">PRIMARY</a> block provides base spans cited from sequeces of primary entries that contribute to regions of the TPA sequence.</li> </ul> </dd> </dl> <h2 id="Sample_of_TPA_flat_file">Sample of TPA flat file</h2> <pre><code><a id="LocusA" href="/ddbj/flat-file-e#LocusB">LOCUS</a> <a id="LocusNameA" href="/ddbj/flat-file-e#LocusNameB">BR000000</a> <a id="SequenceLengthA" href="/ddbj/flat-file-e#SequenceLengthB">2000 bp</a> <a id="MoleculeTypeA" href="/ddbj/flat-file-e#MoleculeTypeB">mRNA</a> <a id="ModificationDateA" href="/ddbj/flat-file-e#ModificationDateB">linear</a> <a id="DivisionA" href="/ddbj/flat-file-e#DivisionB">HUM</a> <a id="ModificationDateA" href="/ddbj/flat-file-e#ModificationDateB">17-SEP-2006</a> <a id="DefinitionA" href="/ddbj/flat-file-e#DefinitionB">DEFINITION</a> TPA_exp: Homo sapiens GAPD gene for glyceraldehyde-3-phosphate dehydrogenase, complete cds. <a id="AccessionA" href="/ddbj/flat-file-e#AccessionB">ACCESSION</a> BR000000 <a id="VersionA" href="/ddbj/flat-file-e#VersionB">VERSION</a> BR000000.1 <a id="KeywordsA" href="/ddbj/flat-file-e#KeywordsB">KEYWORDS</a> Third Party Data; TPA; TPA:experimental. <a id="SourceA" href="/ddbj/flat-file-e#SourceB">SOURCE</a> Homo sapiens (human) <a id="OrganismA" href="/ddbj/flat-file-e#OrganismB">ORGANISM</a> Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. <a id="Reference1A" href="/ddbj/flat-file-e#Reference1B">REFERENCE 1</a> (bases 1 to 2000) <a id="AuthorsA" href="/ddbj/flat-file-e#AuthorsB">AUTHORS</a> Mishima,H. and Shizuoka,T. <a id="TitleA" href="/ddbj/flat-file-e#TitleB">TITLE</a> Direct Submission <a id="JournalA" href="/ddbj/flat-file-e#JournalB">JOURNAL</a> Submitted (30-NOV-2005) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan <a id="Reference2A" href="/ddbj/flat-file-e#Reference2B">REFERENCE 2</a> AUTHORS Mishima,H., Shizuoka,T. and Fuji,I. TITLE Glyceraldehyde-3-phosphate dehydrogenase of human JOURNAL TPA Biol Chem 10, 50-59 (2006) <a id="CommentA" href="/ddbj/flat-file-e#CommentB">COMMENT</a> <a id="PrimaryA" href="#PrimaryB">PRIMARY</a> TPA_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1000 ZZ000001.1 50001-51000 101-200 ZZ000003.1 1-100 501-600 ZZ000003.1 101-200 901-2000 ZZ000002.1 25001-26100 c 1451-1550 ZZ000003.1 201-300 <a id="FeaturesA" href="/ddbj/flat-file-e#FeaturesB">FEATURES</a> Location/Qualifiers <a id="FeaturesSourceA" href="/ddbj/flat-file-e#FeaturesSourceB">source</a> <a href="/ddbj/location-e.html">1..2000</a> /<a href="/ddbj/qualifiers-e.html#collection_date">collection_date</a>="2007" /<a href="/ddbj/qualifiers-e.html#db_xref">db_xref</a>="taxon:9606" /<a href="/ddbj/qualifiers-e.html#geo_loc_name">geo_loc_name</a>="Japan" /<a href="/ddbj/qualifiers-e.html#mol_type">mol_type</a>="genomic DNA" /<a href="/ddbj/qualifiers-e.html#organism">organism</a>="Homo sapiens" <a href="/ddbj/features-e.html#CDS">CDS</a> <a href="/ddbj/location-e.html">join(153..200,501..600,1451..1500)</a> /<a href="/ddbj/qualifiers-e.html#codon_start">codon_start</a>=1 /<a href="/ddbj/qualifiers-e.html#gene">gene</a>="GAPD" /<a href="/ddbj/qualifiers-e.html#product">product</a>="glyceraldehyde-3-phosphate dehydrogenase" /<a href="/ddbj/qualifiers-e.html#protein_id">protein_id</a>="FAA00000.1" /<a href="/ddbj/qualifiers-e.html#transl_table">transl_table</a>=1 /<a href="/ddbj/qualifiers-e.html#translation">translation</a>="MWYQSLVIIEKLNLEANIGKLINTKDNINIRCRLSHTEEHSWHS NNSQLNLIVDLIYNFYINWSK" <a id="BaseCountA" href="#BaseCountB">BASE COUNT</a> 522 a 493 c 524 g 461 t <a id="OriginA" href="#OriginB">ORIGIN</a> 1 attaatataa gctaaatatg tttttcaata tatattgata atagaatatc aacaatttgg : -- The rest of sequence is omitted -- : <a id="EndA" href="/ddbj/flat-file-e#EndB">//</a></code></pre> </main> <aside class="related-pages"> <h2 class="caption">Related pages</h2> <div class="navigation"> <nav> <ul> <li> <a href="/ddbj/genome-e.html">Data Submission from Genome Project</a> </li> <li> <a href="/ddbj/environmental-e.html">Submission of environmental sequences</a> </li> <li> <a href="/ddbj/transcriptome-e.html">Data Submission from Transcriptome Project</a> </li> </ul> </nav> </div> </aside> </section> </div> </section> </div> <footer></footer> <div id="back-top"></div> </body> </html>