Aggrescan3D: Project manager

<!doctype html> <html lang='en'> <head>  <script async src="https://www.googletagmanager.com/gtag/js?id=UA-132051696-1"></script> <script> window.dataLayer = window.dataLayer || []; function gtag(){dataLayer.push(arguments);} gtag('js', new Date()); gtag('config', 'UA-132051696-1'); </script> <link rel="icon" type="image/png" href="/A3D2/static/img/favicon.png" /> <meta charset="utf-8"> <meta name="description" content="server for prediction of aggregation propensity in protein structures and rational design of protein solubility. In dynamic mode, A3D takes into account the flexibility of natural and designed polypeptides. " /> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title> Aggrescan3D: Project manager</title> <link rel="stylesheet" href="/A3D2/static/css/font-awesome.min.css"> <link rel="stylesheet" href="/A3D2/static/css/bootstrap.min.css"> <link rel="stylesheet" href="/A3D2/static/css/bootstrap-theme.min.css"> <link rel="stylesheet" href="/A3D2/static/css/my_custom.css"> <meta name="viewport" content="width=device-width, initial-scale=1.0">  <link rel="stylesheet" href="/A3D2/static/css/jasny-bootstrap.min.css"> <link rel="stylesheet" type="text/css" href="/A3D2/static/css/font-awesome.min.css"> </head>  <body> <div class="navbar navbar-custom navbar-static-top" role="navigation"> <div class="container"> <div class="navbar-header"> <button type="button" class="navbar-toggle" data-toggle="collapse" data-target=".navbar-collapse"> <span class="sr-only">Toggle navigation</span> </button> <a class="navbar-brand" href="/A3D2/"> <img width=28 class="img-thumbnail" src=/A3D2/static/img/samologo.png></a> <a class="navbar-brand" href="/A3D2/">A3D Server</a> </div> <div class="navbar-collapse collapse"> <ul class="nav navbar-nav navbar-left"> <li><a href="/A3D2/queue"><i class="fa fa-reorder"></i> Server Queue</a></li> <li><a href="/A3D2/MODB"><i class="fa fa-gears "></i> MODataBase</a></li> <li><a href="https://biocomp.chem.uw.edu.pl/a4d/"><i class="fa fa-bookmark"></i><strong> A4D Server</strong></a></li> </ul> <ul class="nav navbar-nav navbar-right"> <li><a href="/A3D2/learn_more"><i class="fa fa-cube"></i> About</a></li> <li><a href="/A3D2/tutorial"><i class="fa fa-question-circle"></i> Tutorial</a></li> <li><a href="/A3D2/contact"><i class="fa fa-envelope-o"></i> Contact</a></li> <form method="GET" action="/A3D2/queue" class="navbar-form navbar-right" role="search"> <div class="form-group"> <input type="text" class="form-control" placeholder="project name search" name="q" id="q"> </div> </form> </ul> </div> </div> </div> <div class="container"> <div class="row"> <div class="col-md-12"> </div> </div> </div> <div class="container" style="padding-right: 0; font-family: IBMPlexSans; font-weight: 400;"> <div style="align-items: center; background-color: rgba(144, 25, 50, 0.5); padding: 20px 15px; display: flex; flex-wrap: wrap; align-content:flex-end;"> <div style="width: 68%; color: white; font-size: 22px; font-family: IBMPlexSans; text-align: left; display: inline-block;">A3D Database |<span style="font-weight: 500;"> Solubility and Aggregation Properties</span></div> <div style="width: 2%; color: white; font-size: 22px; font-weight: 900; text-align: center; display: inline-block;">|</div> <div style="width: 29%; color: white; font-size: 20px; text-align: right; display: inline-block; align-items: center; "> <button class="tablink" style="width: fit-content;" onclick="openPage('Home', this, 'rgba(102, 117, 127, 0.0')"id="defaultOpen">Home</button> <button class="tablink" style="width: fit-content;" onclick="openPage('About', this, 'rgba(102, 117, 127, 0.0')">About</button> <button class="tablink" style="width: fit-content;" onclick="openPage('News', this, 'rgba(102, 117, 127, 0.0')" >Cite</button> <button class="tablink" style="width: fit-content;" onclick="openPage('Contact', this, 'rgba(102, 117, 127, 0.0')">Download</button> </div> </div> <div id="Home" class="tabcontent"> <div id="banner" style="width: 100%; height: fit-content; background-image: url('/A3D2/static/img/A3D_database_background.png'); background-size: cover; background-position: center; margin: 0; padding: 0; position: relative;"> <div style="align-items: center; padding: 20px 15px 0 15px;"> <div style="color: #8b0000; font-family: IBMPlexSans; font-size: 64px; text-align: center;">A3D Database</div> <div style="color: #8b0000; font-family: IBMPlexSans; font-size: 62px; text-align: center; margin-bottom: 10px;">for the Human Proteome</div> </div> <div class="row cenetered-container" style="cenetered-container; margin-top: 0px;"> <div class="container col-8 cenetered-container"> <form class="form-horizontal cenetered-container " id="af_form" role="form" enctype="multipart/form-data" method="POST" action="/A3D2/hproteome"> <div class="af-search-text"><i>Search for UniProt ID, gene, or name of the protein</i></div> <div style="margin: 0; width: 100%;"><input type="text" class="form-control" id="search_text" name="search_text" placeholder="LV3" value=""></div> <div style="margin-top: 0; display: flex; align-items: center; justify-content: space-evenly; height: 25px;"> <p class="af-example-text"><i>Examples: </i></p> <button class="af-example-btn" style="width: 70px; margin: 0 1px;" value="Q7Z7G8" onclick="loadExample(this)">Q7Z7G8</button> <button class="af-example-btn" style="width: 55px; margin: 0 1px;" value="SOD1" onclick="loadExample(this)">SOD1</button> <button class="af-example-btn" style="width: 80px; margin: 0 1px;" value="lactamase" onclick="loadExample(this)">lactamase</button> <button class="af-example-btn" style="width: 40px; margin: 0 1px;" value="p53" onclick="loadExample(this)">p53</button> <button class="af-example-btn" style="width: 190px; margin: 0 1px;" value="Epidermal growth factor" onclick="loadExample(this)">Epidermal growth factor</button>  </div> <button id="submit_main" type="submit" class="btn btn-search" style="background-color: #66757f; margin-top: 25px; margin-bottom: 28px;" value="Submit" ><i class="fa fa-gears"></i> Search </button> </div> </div> </div> <div style="width: 100%; align-items: left; background-color: rgba(102,117,127, 0.4); padding: 20px 15px;"> <div style="color: #1a1a1a; font-size: 17.5px; text-align: center;"> The <b>A3D database</b> provides the analysis of solubility and aggregation properties for human protein structures from the <b><a href="https://alphafold.ebi.ac.uk/" style="color: #3554bd;" target="_blank">AlphaFold Database</a></b>. </div> </div> <div class="row cenetered-container" style="cenetered-container"> <div class="container col-8 cenetered-container"> <div class="centered af-search-text-2"> </div> </div> </div> </div> <div id="About" class="tabcontent"> <div style="background-image: url('/A3D2/static/img/about-1.png'); background-size: 39% auto; background-position: right center; background-repeat: no-repeat; margin: 1vh 0 2vh 0;"> <h1 class="text-about" style="margin-top: 1vh;">About</h1> <h3 class="text-about">Protein <span style="color: #aa0000;">aggregation</span> is associated with highly debilitating <span style="color: #aa0000;">human disorders</span> and constitutes a bottleneck for producing therapeutic proteins. The knowledge of the human protein structures repertoire has dramatically increased with the recent development of the <a href="https://alphafold.ebi.ac.uk/" style="color: #3554bd; font-style: italic;" target="_blank">AlphaFold Database</a> (AF) deep-learning method. Applying the <b><span style="color: #aa0000;">A3D analysis</span></b> on high-quality AF structural predictions can improve the understanding of protein aggregation properties and open the possibility for the rational <span style="color: #aa0000;">design of protein solubility</span>.</h3> </div> <div class="section-about"> <button type="button" class="collapsible-about">Learn more from the <b>video tutorial</b></button> <div class="content-about"> <p align="center"><iframe class="iframe-video" width="810" height="630" src="https://www.youtube.com/embed/cAh-pGsEnW4" title="A3D Database video tutorial" frameborder="0" allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen></iframe></p> </div> </div> <div class="section-about"> <button type="button" class="collapsible-about">Aggrescan3D predictions and analysis</button> <div class="content-about"> <h4 class="text-about spacing full-w"><b>Aggrescan3D</b> (A3D) is a structure-based algorithm that uses three-dimensional protein coordinates to project each amino acid's intrinsic <span style="color: #aa0000;">aggregation propensity</span> value into the structure. Then, the aggregation score is corrected as a function of its specific solvent exposure and the aggregation propensity of neighboring residues within a 10 Å sphere of radius. Given this dependence on the spatial position of each atom of the protein, both the atomic resolution and the biological relevance of the input structures impact A3D prediction's accuracy. <br>Therefore, in order to correctly <span style="color: #aa0000;">interpret A3D database aggregation tendencies</span>, users might consider two critical characteristics of the AlphaFold predictions: <br>• Structure confidence and disorder <br>• Quaternary structure context <br><i><span style="color:gray;">(see details in the next tab: Source of the structural data: AlphaFold predictions)</span></i> </h4> <div style="height: 275px; background-image: url('/A3D2/static/img/about-2.png'); background-size: 98% auto; background-position: center; background-repeat: no-repeat;"></div> </div> </div> <div class="section-about"> <button type="button" class="collapsible-about">Source of the structural data: AlphaFold predictions</button> <div class="content-about"> <h3 class="text-about"><span style="color: #aa0000;">Structure confidence and disorder</span></h3> <div style="background-image: url('/A3D2/static/img/about-3.png'); background-size: 42% auto; background-position: right top; background-repeat: no-repeat;"> <h4 class="text-about spacing">AF predicted structures cover 98.5% of the human proteome and involve complete protein chains in their monomeric state. Each amino acid in an AF model has a confidence score (pLDDT) that ranges from 0 to 100, indicating which regions could be considered equivalent to an experimentally determined structure. It is estimated that around <span style="color: #aa0000;">30% of the amino acids of the human proteome</span> are located in non-globular regions, such as <span style="color: #aa0000;">intrinsically disordered</span> regions. Therefore, it is not surprising that AF predicted structures regularly include <span style="color: #aa0000;">regions with low pLDDT scores</span> (<a href="https://pubmed.ncbi.nlm.nih.gov/34418423/" style="color: #3554bd; font-style: italic;" target="_blank">PMID</a>). These permanently or transiently disordered segments are often not defined in experimental structures, and therefore, till now, A3D was unaware of them. Now they are incorporated in the A3D Database. A3D predictions are blind to the dynamic nature of these regions since AF models correspond to static frames of the conformational ensemble of these regions. Therefore, the presence of disordered low AF confidence regions might <span style="color: #aa0000;">artificially increase the presence of S-APRs</span>* in adjacent high confidence protein domains. <br><i><span style="color:gray;">* (Surface-exposed Aggregation Prone Regions)</span></i> </h4> </div> <h4 class="text-about spacing full-w">To deal with this issue, the A3D dataset includes two additional precalculated structural aggregation profiles per default, which correspond to predicted structures with pLDDT thresholds: >70% and >50% confidence, which were defined after manually curating the 100 randomly selected AF models. </h4> <div style="background-image: url('/A3D2/static/img/about-4.png'); background-size: 40% auto; background-position: right 16%; background-repeat: no-repeat;"> <h4 class="text-about spacing"><b>In the following points, we outline different situations users may face:</b> <br>• Proteins with <span style="color: #aa0000;">high confidence</span> values: the overall AF predicted structure possesses high pLDDTs. All three computed structures converge into a unique aggregation prediction. Well-defined S-APRs can be delineated from A3D output structures. <i><span style="color:gray;">(representative examples: Q68D91, S4R460)</span></i> <br>• Proteins with <span style="color: #aa0000;">limited low confidence</span> regions: proteins that display local surface modifications with confidence thresholds of >70% or >50% pLDDT. An increase or decrease of localized S-APRs can be observed. <br><i><span style="color:gray;">(representative examples: P09382, Q9UKL6, Q5EE01)</span></i> <br>• <span style="color: #aa0000;">Multidomain proteins</span>: proteins with two or more globular domains that correspond to well-defined and confident regions, while tethering elements that connect globular domains possess low pLDDT values. The analysis with restricted pLDDT thresholds often results in disconnected domains and, as a consequence, some previous sheltered APR might become exposed. As a result, S-APRs might diverge in the tree models, and their boundaries are less evident. <br><i><span style="color:gray;">(representative examples: Q96MN5, Q96DA0)</span></i> <br>• Proteins with <span style="color: #aa0000;">extended low-confidence</span> regions: proteins with large low confidence regions localized in flexible C-, N- termini, or long loops, usually displayed around a well-defined globular core. With the 70% and 50% pLDDTs cutoffs, disordered regions are often excluded from the model and, therefore, not considered in A3D prediction. As a result, the A3D predictions correspond to well-defined globular domains. Note that we might observe the presence of free amino acids in some cases, unattached to the protein main chain, essentially because they are in the exclusion limit between two pLDDT thresholds. <br><i><span style="color:gray;">(representative examples: Q9NRE2, Q8NFW1)</span></i> <br>• Proteins with <span style="color: #aa0000;">overall low confidence</span>: usually, short polypeptides that are mostly disordered, exposing most of its surface to solvent. In some cases, we lose all the structure in predictions corresponding to >70% or >50% pLDDT threshold. <br><i><span style="color:gray;">(representative examples: Q8N9P0, Q8TEV8, Q9GZY1)</span></i> </h4> </div> <h3 class="text-about"><span style="color: #aa0000;">Quaternary structure context</span></h3> <h4 class="text-about spacing full-w">In the AF database, structure predictions are restricted to single chains. This precludes the analysis of the quaternary structure context in the A3D Database. The overlap between the physicochemical properties governing protein-protein native interactions and non-native contacts triggering aberrant self-assembly implies that protein interfaces are enriched in S-APRs. In proteins displaying quaternary structure, this results in an over-prediction of S-APRs in protein monomers, relative to native the same subunits in the oligomeric state. </h4> <h3 class="text-about"><span style="color: #aa0000;">Gathering important information</span></h3> <h4 class="text-about spacing full-w">We strongly encourage users to compile as much as possible information about their case study protein to exploit A3D predictions. <br>Some <span style="color: #aa0000;">helpful questions</span> to shape the output would be: <br>• (i) Does the protein possess disordered regions? <br>• (ii) Do these disordered segments correlate with low pLDDT? <br>• (iii) Does the protein bind another protein? Does it form a homo- or hetero-oligomer? <br>• (iv) Does the protein contain a signal peptide? <br>• (v) Is the protein the mature form or on the contrary, is a proprotein? <br><br>In addition to the aforementioned pieces of advice, we also recommend reviewing <span style="color: #aa0000;">dedicated bibliography</span> on how to manage the A3D algorithm and how to evaluate its aggregation predictions: <br>1. <a href="https://pubmed.ncbi.nlm.nih.gov/29594784/" style="color: #3554bd; font-style: italic;" target="_blank" >AGGRESCAN3D: Toward the Prediction of the Aggregation Propensities of Protein Structures</a>, Methods Mol Biol. 2018, 1762:427-443. <br>2. <a href="https://pubmed.ncbi.nlm.nih.gov/31049593/" style="color: #3554bd; font-style: italic;" target="_blank" >Aggrescan3D (A3D) 2.0: prediction and engineering of protein solubility</a>, Nucleic Acids Res. 2019, 47(W1):W300-W307. <br>3. <a href="https://pubmed.ncbi.nlm.nih.gov/25883144/" style="color: #3554bd; font-style: italic;" target="_blank" >AGGRESCAN3D (A3D): server for prediction of aggregation properties of protein structures</a>, Nucleic Acids Res. 201, 43(W1):W306-13. <br>4. <a href="https://pubmed.ncbi.nlm.nih.gov/32637039/" style="color: #3554bd; font-style: italic;" target="_blank" >Computational prediction of protein aggregation: Advances in proteomics, conformation-specific algorithms and biotechnological applications</a>, Comput Struct Biotechnol J. 2020, 18:1403-1413. </h4> </div> </div> <div class="section-about"> <button type="button" class="collapsible-about">Database construction</button> <div class="content-about"> <h4 class="text-about spacing full-w">The AlphaFold Protein Structure Database collects 23391 predictions assigned to the <span style="color: #aa0000;"><i>Homo sapiens</i> proteome</span>, corresponding to 20504 unique UniProt entries. This set covers well the subset of human proteins with reviewed status, which are longer than 16 amino acids. The extremely long sequences (longer than 2700 residues and up to 34350) were split into overlapping fragments and modeled independently. As a result, the AF-DB provides multiple structure predictions, a few to several dozen, for a particular UniProt identifier. <br>The surface of membrane proteins exhibits distinct physicochemical properties that exert a considerable influence on A3D predictions. Consequently, we have identified a comprehensive set of <span style="color: #22bd9f;">transmembrane and intramembrane</span> proteins, totaling 5934 in count. Expanding the scope of this database, we have included membrane proteins, encompassing not only A3D-derived aggregation predictions but also providing TOPCONS-generated membrane predictions. This augmented approach has been further enhanced by annotation with <span style="color: #22bd9f;">signal peptide</span> information for 4360 entries. <br><br>For all the proteins, we collected the <span style="color: #aa0000;">rich annotations</span>. They include <i>UniProt identifier</i>, <i>gene</i>, <i>common short name</i>, and <i>long descriptive name</i>. One can use any of them to search both AF and A3D databases. For the user's convenience, we also added information about the length of the original sequence. In addition, for sequences split into fragments (209), we provided the region corresponding to the predicted structure. It can make it much easier to <span style="color: #aa0000;">identify a domain</span> of interest to the user. <br>Because the AF-predicted <span style="color: #aa0000;">structures vary considerably in confidence</span> level, we also report for each entry the number of residues below a threshold of 70 and 50, which can help to <span style="color: #aa0000;">screen out underpredictions</span> for user-defined A3D analysis. <br>The unified and integrated metadata accompanied by referencing identifiers in the A3D database is available for <span style="color: #aa0000;">download in CSV format</span>. </h4> </div> </div> <div class="section-about"> <button type="button" class="collapsible-about">Testing mutations using A3D on AlphaFold models</button> <div class="content-about"> <h4 class="text-about spacing full-w">A3D has been shown to be accurate in predicting the changes in the <span style="color: #aa0000;">solubility of globular proteins upon mutation</span> (<a href="https://pubmed.ncbi.nlm.nih.gov/25883144/" style="color: #3554bd; font-style: italic;" target="_blank" >PMID</a>). We compared the <span style="color: #aa0000;">performance of A3D</span> when modeling the impact of mutations on the solubility on top of either the experimental structures or the equivalent AF-derived models, using the mutation editor in the A3D database. To this aim, we selected a reduced set of structurally and sequentially unrelated proteins <i><span style="color:gray;">(see the manuscript Supplementary Information, Table S2 and Figure S5)</span></i>. <br>The predictions turned out to be <span style="color: #aa0000;">accurate and coincident</span> for all the proteins, independently of the kind of structural input we used. In addition to <span style="color: #aa0000;">changes in solubility</span>, A3D provides the impact of the selected mutations on <span style="color: #aa0000;">protein stability</span>, as calculated by <b>FoldX</b> (<a href="https://pubmed.ncbi.nlm.nih.gov/15980494/" style="color: #3554bd; font-style: italic;" target="_blank" >PMID</a>). Importantly, it has been shown that the quality of AF-models is sufficient to predict protein solubility changes upon mutation using <b>FoldX</b> (<a href="https://www.biorxiv.org/content/10.1101/2021.09.26.461876v1" style="color: #3554bd; font-style: italic;" target="_blank" >PMID</a>). </h4> </div> </div> <div class="section-about"> <button type="button" class="collapsible-about">Downloading results through a REST API</button> <div class="content-about"> <h4 class="text-about spacing full-w"> AA Each hproteome job's results can be downloaded via the REST API. A job can be identified by an unique identifier called a job id. A sample Python script is provided below that will allow to download the entire results for the specific job. For other usages of the API please see the main page tutorial. The job ID can be found in the address of the web browser when viewing the job. For example http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/65417ebb9b66183/ would mean that the job ID = 65417ebb9b66183. In the Download tab A3D_Database.csv file can be downloaded which contains IDs of all the non-custom jobs. <pre> #!/usr/bin/env python import requests req = requests.get('http://biocomp.chem.uw.edu.pl/A3D2/RESTful/hproteome_job/job_id/') print(req.status_code) data = req.json() for k in data.keys(): print("key: %s: %s" % (k, data[k])) </pre> The script should return data in the following format, a 404 response indicates a job id that doesn't exist on the database. <pre> key: A3Dscore: {'avg': -0.5321, 'max': 1.8543, 'min': -2.6878, 'sum': -51.0901, 'tab': [['1', 'E', 'A', '-1.3183'], ['2', 'V', 'A', '0.4278'], ... ]} key: af_data: {'conf_cutoff': '50.00', 'full_protein': True, 'gene': 'IGHV3OR16-9', 'long_name': 'Immunoglobulin heavy variable 3/OR16-9 (non-functional)', 'n_res': 96, 'organism': 'Homo sapiens', 'region': '1-97', 'scores': [[1, 'GLU', '89.30'], [2, 'VAL', '94.18'], ... ], 'segment': 1, 'seq_len': 97, 'uniprot_id': 'S4R460' } key: aggregation_distance: 10 key: automated_mutations: None key: chain_sequence: EVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYTSWVRQAPGKGLEWVSYSSGNSGYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYC key: dynamic_mode: 0 key: mutated_residues: None key: mutation_energetic_effect: 0.0 key: mutation_mode: 0 key: project_name: AF-S4R460-F1_c50 key: stability_calculations: 1 key: started: Mon, 23 Aug 2021 13:05:35 GMT key: status: done key: updated: Mon, 23 Aug 2021 13:06:30 GMT </pre> </h4> </div> </div> </div> <div id="News" class="tabcontent"> <h1 class="text-about" style="margin-top: 2vh;">Papers & Methods</h1> <h3 class="text-about"><span style="color: #aa0000;">Papers describing A3D database:</span></h3> <h4 class="text-about spacing full-w"> 1. <a href="" style="color: #507ac6; font-style: italic;" target="_blank" >A3D Model Organism Database (A3D-MODB): a database for proteome aggregation predictions in model organisms </a>, submitted, 2023 <br> 2. <a href="https://academic.oup.com/bioinformatics/article-abstract/38/11/3121/6571807" style="color: #507ac6; font-style: italic;" target="_blank" >A3D database: structure-based predictions of protein aggregation for the human proteome</a>, Bioinformatics, 38(11):3121-312, 2022 <br> 3. <a href="https://microbialcellfactories.biomedcentral.com/articles/10.1186/s12934-023-02182-3" style="color: #507ac6; font-style: italic;" target="_blank" >A3DyDB: Exploring Structural Aggregation Propensities in the Yeast Proteome</a>, Microbial Cell Factories 22:186, 2023.. </h4><br><br> <h3 class="text-about"><span style="color: #aa0000;">The papers describing A3D method and its applications:</span></h3> <h4 class="text-about spacing full-w"> 1. <a href="https://academic.oup.com/nar/advance-article/doi/10.1093/nar/gkz321/5485072" style="color: #3554bd; font-style: italic;" target="_blank" >Aggrescan3D (A3D) 2.0: prediction and engineering of protein solubility</a>, Nucleic Acids Research, gkz321, 2019. <br>2. <a href="https://academic.oup.com/bioinformatics/advance-article/doi/10.1093/bioinformatics/btz143/5368526" style="color: #3554bd; font-style: italic;" target="_blank" >Aggrescan3D standalone package for structure-based prediction of protein aggregation properties</a>, Bioinformatics, btz143, 2019. <br>3. <a href="https://academic.oup.com/nar/article/43/W1/W306/2467885" style="color: #3554bd; font-style: italic;" target="_blank" >AGGRESCAN3D (A3D): server for prediction of aggregation properties of protein structures</a>, Nucleic Acids Res., 43, W306-W313, 2015. <br>4. <a href="https://pubs.acs.org/doi/10.1021/acs.molpharmaceut.8b00341" style="color: #3554bd; font-style: italic;" target="_blank" >Combining Structural Aggregation Propensity and Stability Predictions To Redesign Protein Solubility</a>, Molecular Pharmaceutics, 15(9), 3846-3859, 2018. <br><br><b>The example guide for A3D 2.0:</b> <br>5. <a href="https://www.biorxiv.org/content/10.1101/2021.04.13.439600v1" style="color: #3554bd; font-style: italic;" target="_blank" >A3D 2.0 update for the prediction and optimization of protein solubility</a>, Methods in Molecular Biology (biorxiv preprint), 2021. </h4> </div> <div id="Contact" class="tabcontent"> <h1 class="text-about" style="margin-top: 2vh;">Download</h1> <h3 class="text-about"><span style="color: #aa0000;">Download the results of A3D analysis</span></h3> <h4 class="text-about spacing full-w"> The results of the A3D analysis are available for download on the subpage dedicated to a particular entry in the A3D database. <br>Please use the search form, available at the <a href="http://biocomp.chem.uw.edu.pl/A3D2/hproteome" style="color: #3554bd; font-style: italic;" >A3D Database Home tab</a>, to find the protein of your interest. <br>The A3D predictions of aggregation and solubility properties can be downloaded in CSV format (raw data) from the <i>Aggrescan3D score</i> tab, or as a graphical profile (image) from the <i>Aggrescan3D plot</i> tab. <br>The structural data can be downloaded in PDB format from the <i>Structure</i> tab. The images of user-taken snapshots are saved automatically in the <i>Gallery</i> tab and available for download. </h4><br><br> <h3 class="text-about"><span style="color: #aa0000;">Download the annotations</span></h3> <h4 class="text-about spacing full-w"> The unified and integrated metadata accompanied by referencing identifiers in the A3D database is available for download in CSV format.<br><br> <a href="/A3D2/static/download/A3D-HSAPIENS.csv" download="A3D_Human_Database.csv" style="font-size: 22px; font-weight: 600; color: #3554bd;"><img src="/A3D2/static/img/db_download.png" width="40" height="40" alt="A3D Database: Solubility and Aggregation Properties for the Human Proteome">   A3D-HSAPIENS.csv</a> </h4> <h3 class="text-about"><span style="color: #aa0000;">Download the data</span></h3> <h4 class="text-about spacing full-w"> The unified and integrated metadata accompanied by referencing identifiers in the A3D database is available for download in CSV format.<br><br> <a href="/A3D2/static/download/HUMAN_SCORES.tar.gz" download="HUMAN_SCORES.tar.gz" style="font-size: 22px; font-weight: 600; color: #3554bd;"><img src="/A3D2/static/img/db_download.png" width="40" height="40" alt="A3D Database: Solubility and Aggregation Properties for the Human Proteome">   HUMAN_SCORES.tar.gz</a> </h4> </div> </div> <div class="container"> <hr><small class="text-muted" style="float:right">Laboratory of Theory of Biopolymers 2018</small> </div> <script src="/A3D2/static/js/jquery.js"></script> <script src="/A3D2/static/js/bootstrap.min.js"></script> <script src="/A3D2/static/js/hyp.js"></script> <script src="/A3D2/static/js/jasny-bootstrap.min.js"></script> <script> function loadExample(val) { var input = document.querySelector('[placeholder="LV3"]'); input.value = val.value; } </script> <script> function openPage(pageName,elmnt,color) { var i, tabcontent, tablinks; tabcontent = document.getElementsByClassName("tabcontent"); for (i = 0; i < tabcontent.length; i++) { tabcontent[i].style.display = "none"; } tablinks = document.getElementsByClassName("tablink"); for (i = 0; i < tablinks.length; i++) { tablinks[i].style.backgroundColor = "rgba(102, 117, 127, 0)"; tablinks[i].style.borderBottom = "0px solid #8b0000"; tablinks[i].style.fontWeight = "500"; tablinks[i].style.color = "white"; } document.getElementById(pageName).style.display = "block"; elmnt.style.fontWeight = "900"; elmnt.style.color = "#8b0000"; } document.getElementById("defaultOpen").click(); </script> <script> var coll = document.getElementsByClassName("collapsible-about"); var i; for (i = 0; i < coll.length; i++) { coll[i].addEventListener("click", function() { this.classList.toggle("active-collaps"); var content = this.nextElementSibling; if (content.style.display === "block") { content.style.display = "none"; } else { content.style.display = "block"; } }); } </script> <script> $(document).keydown(function (event) { //proper indentiation of keycode and which to be equal to 13. if ( (event.keyCode || event.which) === 13) { // Cancel the default action, if needed event.preventDefault(); //call function, trigger events and everything tou want to dd . ex : Trigger the button element with a click $("#submit_main").trigger('click'); } }); $("form#af_form").submit(function(e) { x=document.getElementById("submit_main"); x.disabled=true; setTimeout(enable, 3000); }); function enable() { x.disabled=false; } function temporaryDisable(el) { var oldLabel = el.value; el.value = "Creating..."; el.disabled = true; setTimeout(function() { el.disabled = false; el.value = oldLabel; }, 3000); } function load_full_uniprot() { $('#uniprot_results').empty(); $('#load_uniprot').empty(); var rows = ''; for (var prop in uniprot_data) { rows = rows + "<tr><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + uniprot_data[prop][0] + "</a></td><td class='col-md-2'>" + uniprot_data[prop][1] + "</td><td class='col-md-4'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + uniprot_data[prop][2] + "</a></td><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + uniprot_data[prop][3] + "</a></td><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + uniprot_data[prop][4] + "</a></td>" } $('#uniprot_results').html(rows); } function load_full_gene() { $('#gene_results').empty(); $('#load_gene').empty(); var rows = ''; for (var prop in gene_data) { rows = rows + "<tr><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + gene_data[prop][0] + "</a></td><td class='col-md-2'>" + gene_data[prop][1] + "</td><td class='col-md-4'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + gene_data[prop][2] + "</a></td><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + gene_data[prop][3] + "</a></td><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + gene_data[prop][4] + "</a></td>" } $('#gene_results').html(rows); } function load_full_long_name() { $('#long_name_results').empty(); $('#load_long_name').empty(); var rows = ''; for (var prop in long_name_data) { rows = rows + "<tr><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + long_name_data[prop][0] + "</a></td><td class='col-md-2'>" + long_name_data[prop][1] + "</td><td class='col-md-4'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + long_name_data[prop][2] + "</a></td><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + long_name_data[prop][3] + "</a></td><td class='col-md-2'><a href='http://biocomp.chem.uw.edu.pl/A3D2/hproteome_job/" + prop + "'>" + long_name_data[prop][4] + "</a></td>" } $('#long_name_results').html(rows); } $(".accordion-01 .set > a").on("click", function(){ if($(this).hasClass('active')) { $(this).removeClass("active"); $(this).siblings('.content').slideUp(200); $(".accordion-01 .set > a i").removeClass("fa-minus").addClass("fa-plus"); } else { $(".accordion-01 .set > a i").removeClass("fa-minus").addClass("fa-plus"); $(this).find("i").removeClass("fa-plus").addClass("fa-minus"); $(".accordion-01 .set > a").removeClass("active"); $(this).addClass("active"); $('.accordion-01 .content').slideUp(200); $(this).siblings('.content').slideDown(200); } tab_name = $(".accordion-01 .set > a.active").text(); if (tab_name) { click_content = window.location.pathname + "/" + $(".accordion-01 .set > a.active").text(); ga('send', 'pageview', click_content); } }); </script> </body> </html>

CINXE.COM

Aggrescan3D: Project manager