CINXE.COM

History Books

<!DOCTYPE html> <html class="desktop withSiteHeaderTopFullImage "> <head> <title>History Books</title> <meta content='History genre: new releases and popular books, including Didion and Babitz by Lili Anolik, Vanishing Treasures: A Bestiary of Extraordinary Endangered Cr...' name='description'> <meta content='telephone=no' name='format-detection'> <link href='https://www.goodreads.com/genres/history' rel='canonical'> <script type="text/javascript"> var ue_t0=window.ue_t0||+new Date(); </script> <script type="text/javascript"> var ue_mid = "A1PQBFHBHS6YH1"; var ue_sn = "www.goodreads.com"; var ue_furl = "fls-na.amazon.com"; var ue_sid = "437-4012818-0367154"; var ue_id = "WN4AZYDEN36QC86AV8MA"; (function(e){var c=e;var a=c.ue||{};a.main_scope="mainscopecsm";a.q=[];a.t0=c.ue_t0||+new Date();a.d=g;function g(h){return +new Date()-(h?0:a.t0)}function d(h){return function(){a.q.push({n:h,a:arguments,t:a.d()})}}function b(m,l,h,j,i){var k={m:m,f:l,l:h,c:""+j,err:i,fromOnError:1,args:arguments};c.ueLogError(k);return false}b.skipTrace=1;e.onerror=b;function f(){c.uex("ld")}if(e.addEventListener){e.addEventListener("load",f,false)}else{if(e.attachEvent){e.attachEvent("onload",f)}}a.tag=d("tag");a.log=d("log");a.reset=d("rst");c.ue_csm=c;c.ue=a;c.ueLogError=d("err");c.ues=d("ues");c.uet=d("uet");c.uex=d("uex");c.uet("ue")})(window);(function(e,d){var a=e.ue||{};function c(g){if(!g){return}var f=d.head||d.getElementsByTagName("head")[0]||d.documentElement,h=d.createElement("script");h.async="async";h.src=g;f.insertBefore(h,f.firstChild)}function b(){var k=e.ue_cdn||"z-ecx.images-amazon.com",g=e.ue_cdns||"images-na.ssl-images-amazon.com",j="/images/G/01/csminstrumentation/",h=e.ue_file||"ue-full-11e51f253e8ad9d145f4ed644b40f692._V1_.js",f,i;if(h.indexOf("NSTRUMENTATION_FIL")>=0){return}if("ue_https" in e){f=e.ue_https}else{f=e.location&&e.location.protocol=="https:"?1:0}i=f?"https://":"http://";i+=f?g:k;i+=j;i+=h;c(i)}if(!e.ue_inline){if(a.loadUEFull){a.loadUEFull()}else{b()}}a.uels=c;e.ue=a})(window,document); if (window.ue && window.ue.tag) { window.ue.tag('genres:show:signed_out', ue.main_scope);window.ue.tag('genres:show:signed_out:desktop', ue.main_scope); } </script> <!-- * Copied from https://info.analytics.a2z.com/#/docs/data_collection/csa/onboard */ --> <script> //<![CDATA[ !function(){function n(n,t){var r=i(n);return t&&(r=r("instance",t)),r}var r=[],c=0,i=function(t){return function(){var n=c++;return r.push([t,[].slice.call(arguments,0),n,{time:Date.now()}]),i(n)}};n._s=r,this.csa=n}(); if (window.csa) { window.csa("Config", { "Application": "GoodreadsMonolith", "Events.SushiEndpoint": "https://unagi.amazon.com/1/events/com.amazon.csm.csa.prod", "Events.Namespace": "csa", "CacheDetection.RequestID": "WN4AZYDEN36QC86AV8MA", "ObfuscatedMarketplaceId": "A1PQBFHBHS6YH1" }); window.csa("Events")("setEntity", { session: { id: "437-4012818-0367154" }, page: {requestId: "WN4AZYDEN36QC86AV8MA", meaningful: "interactive"} }); } var e = document.createElement("script"); e.src = "https://m.media-amazon.com/images/I/41mrkPcyPwL.js"; document.head.appendChild(e); //]]> </script> <script type="text/javascript"> if (window.Mobvious === undefined) { window.Mobvious = {}; } window.Mobvious.device_type = 'desktop'; </script> <script src="https://s.gr-assets.com/assets/webfontloader-3aab2cc7a05633c1664e2b307cde7dec.js"></script> <script> //<![CDATA[ WebFont.load({ classes: false, custom: { families: ["Lato:n4,n7,i4", "Merriweather:n4,n7,i4"], urls: ["https://s.gr-assets.com/assets/gr/fonts-e256f84093cc13b27f5b82343398031a.css"] } }); //]]> </script> <link rel="stylesheet" media="all" href="https://s.gr-assets.com/assets/goodreads-e885b69aa7e6b55052557e48fb5e6ae6.css" /> <link rel="stylesheet" media="screen" href="https://s.gr-assets.com/assets/common_images-f5630939f2056b14f661a80fa8503dca.css" /> <script src="https://s.gr-assets.com/assets/desktop/libraries-c07ee2e4be9ade4a64546b3ec60b523b.js"></script> <script src="https://s.gr-assets.com/assets/application-c9ca2b0a96b7d9468fe67c9b30eec3fc.js"></script> <script> //<![CDATA[ var gptAdSlots = gptAdSlots || []; var googletag = googletag || {}; googletag.cmd = googletag.cmd || []; (function() { var gads = document.createElement("script"); gads.async = true; gads.type = "text/javascript"; var useSSL = "https:" == document.location.protocol; gads.src = (useSSL ? "https:" : "http:") + "//securepubads.g.doubleclick.net/tag/js/gpt.js"; var node = document.getElementsByTagName("script")[0]; node.parentNode.insertBefore(gads, node); })(); // page settings //]]> </script> <script> //<![CDATA[ googletag.cmd.push(function() { googletag.pubads().setTargeting("sid", "osid.d92a6d71b2d273571fea7a0b37c9286b"); googletag.pubads().setTargeting("grsession", "osid.d92a6d71b2d273571fea7a0b37c9286b"); googletag.pubads().setTargeting("surface", "desktop"); googletag.pubads().setTargeting("signedin", "false"); googletag.pubads().setTargeting("gr_author", "false"); googletag.pubads().setTargeting("author", []); googletag.pubads().setTargeting("shelf", ["history","past","storia"]); googletag.pubads().setTargeting("tags", ["48","27171","106962"]); googletag.pubads().setTargeting("gtargeting", "27wr29"); googletag.pubads().setTargeting("resource", "genre_history"); googletag.pubads().enableAsyncRendering(); googletag.pubads().enableSingleRequest(); googletag.pubads().collapseEmptyDivs(true); googletag.pubads().disableInitialLoad(); googletag.enableServices(); }); //]]> </script> <script> //<![CDATA[ ! function(a9, a, p, s, t, A, g) { if (a[a9]) return; function q(c, r) { a[a9]._Q.push([c, r]) } a[a9] = { init: function() { q("i", arguments) }, fetchBids: function() { q("f", arguments) }, setDisplayBids: function() {}, _Q: [] }; A = p.createElement(s); A.async = !0; A.src = t; g = p.getElementsByTagName(s)[0]; g.parentNode.insertBefore(A, g) }("apstag", window, document, "script", "//c.amazon-adsystem.com/aax2/apstag.js"); apstag.init({ pubID: '3211', adServer: 'googletag', bidTimeout: 4e3, deals: true, params: { aps_privacy: '1YN' } }); //]]> </script> <meta name="csrf-param" content="authenticity_token" /> <meta name="csrf-token" content="yJUZgLF6h5VO+e9nZzqkrpUbOuKSQ/mpKoWJyzDWP5Z2ASU2+lOivMacAk5nY9WN7ccSYe81+V1EBA2COpDtvA==" /> <meta name="request-id" content="WN4AZYDEN36QC86AV8MA" /> <script src="https://s.gr-assets.com/assets/react_client_side/external_dependencies-2e2b90fafc.js" defer="defer"></script> <script src="https://s.gr-assets.com/assets/react_client_side/site_header-db7e725a27.js" defer="defer"></script> <script src="https://s.gr-assets.com/assets/react_client_side/custom_react_ujs-b1220d5e0a4820e90b905c302fc5cb52.js" defer="defer"></script> <link rel="search" type="application/opensearchdescription+xml" href="/opensearch.xml" title="Goodreads"> <meta name="description" content="History genre: new releases and popular books, including Didion and Babitz by Lili Anolik, Vanishing Treasures: A Bestiary of Extraordinary Endangered Cr..."> <meta content='summary' name='twitter:card'> <meta content='@goodreads' name='twitter:site'> <meta content='History Books' name='twitter:title'> <meta content='History genre: new releases and popular books, including Didion and Babitz by Lili Anolik, Vanishing Treasures: A Bestiary of Extraordinary Endangered Cr...' name='twitter:description'> <meta name="verify-v1" content="cEf8XOH0pulh1aYQeZ1gkXHsQ3dMPSyIGGYqmF53690="> <meta name="google-site-verification" content="PfFjeZ9OK1RrUrKlmAPn_iZJ_vgHaZO1YQ-QlG2VsJs" /> <meta name="apple-itunes-app" content="app-id=355833469"> </head> <body class=""> <div data-react-class="ReactComponents.StoresInitializer" data-react-props="{}"><noscript data-reactid=".actwz3n1do" data-react-checksum="-1385623224"></noscript></div> <script src="https://s.gr-assets.com/assets/fb_dep_form-e2e4a0d9dc062011458143c32b2d789b.js"></script> <div class="content" id="bodycontainer" style=""> <script> //<![CDATA[ var initializeGrfb = function() { $grfb.initialize({ appId: "2415071772" }); }; if (typeof $grfb !== "undefined") { initializeGrfb(); } else { window.addEventListener("DOMContentLoaded", function() { if (typeof $grfb !== "undefined") { initializeGrfb(); } }); } //]]> </script> <script> //<![CDATA[ function loadScript(url, callback) { var script = document.createElement("script"); script.type = "text/javascript"; if (script.readyState) { //Internet Explorer script.onreadystatechange = function() { if (script.readyState == "loaded" || script.readyState == "complete") { script.onreadystatechange = null; callback(); } }; } else { //Other browsers script.onload = function() { callback(); }; } script.src = url; document.getElementsByTagName("head")[0].appendChild(script); } function initAppleId() { AppleID.auth.init({ clientId : 'com.goodreads.app', scope : 'name email', redirectURI: 'https://www.goodreads.com/apple_users/sign_in_with_apple_web', state: 'apple_oauth_state_9ff86563-8a2d-4d43-90a8-db1d1b67d910' }); } var initializeSiwa = function() { var APPLE_SIGN_IN_JS_URL = "https://appleid.cdn-apple.com/appleauth/static/jsapi/appleid/1/en_US/appleid.auth.js" loadScript(APPLE_SIGN_IN_JS_URL, initAppleId); }; if (typeof AppleID !== "undefined") { initAppleId(); } else { initializeSiwa(); } //]]> </script> <div class='siteHeader'> <div data-react-class="ReactComponents.HeaderStoreConnector" data-react-props="{&quot;myBooksUrl&quot;:&quot;/review/list?ref=nav_mybooks&quot;,&quot;browseUrl&quot;:&quot;/book?ref=nav_brws&quot;,&quot;recommendationsUrl&quot;:&quot;/recommendations?ref=nav_brws_recs&quot;,&quot;choiceAwardsUrl&quot;:&quot;/choiceawards?ref=nav_brws_gca&quot;,&quot;genresIndexUrl&quot;:&quot;/genres?ref=nav_brws_genres&quot;,&quot;giveawayUrl&quot;:&quot;/giveaway?ref=nav_brws_giveaways&quot;,&quot;exploreUrl&quot;:&quot;/book?ref=nav_brws_explore&quot;,&quot;homeUrl&quot;:&quot;/?ref=nav_home&quot;,&quot;listUrl&quot;:&quot;/list?ref=nav_brws_lists&quot;,&quot;newsUrl&quot;:&quot;/news?ref=nav_brws_news&quot;,&quot;communityUrl&quot;:&quot;/group?ref=nav_comm&quot;,&quot;groupsUrl&quot;:&quot;/group?ref=nav_comm_groups&quot;,&quot;quotesUrl&quot;:&quot;/quotes?ref=nav_comm_quotes&quot;,&quot;featuredAskAuthorUrl&quot;:&quot;/ask_the_author?ref=nav_comm_askauthor&quot;,&quot;autocompleteUrl&quot;:&quot;/book/auto_complete&quot;,&quot;defaultLogoActionUrl&quot;:&quot;/&quot;,&quot;topFullImage&quot;:{&quot;clickthroughUrl&quot;:&quot;https://www.goodreads.com/choiceawards/best-books-2024?ref=gca_dec_24_gcaw_eb&quot;,&quot;altText&quot;:&quot;Check out the winners of the 2024 Goodreads Choice Awards&quot;,&quot;backgroundColor&quot;:&quot;#f0bf6e&quot;,&quot;xs&quot;:{&quot;1x&quot;:&quot;https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829452i/471.jpg&quot;,&quot;2x&quot;:&quot;https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829458i/472.jpg&quot;},&quot;md&quot;:{&quot;1x&quot;:&quot;https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829440i/469.jpg&quot;,&quot;2x&quot;:&quot;https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829446i/470.jpg&quot;}},&quot;logo&quot;:{&quot;clickthroughUrl&quot;:&quot;/&quot;,&quot;altText&quot;:&quot;Goodreads Home&quot;},&quot;searchPath&quot;:&quot;/search&quot;,&quot;newReleasesUrl&quot;:&quot;/book/popular_by_date/2024/12?ref=nav_brws_newrels&quot;,&quot;signInUrl&quot;:&quot;/user/sign_in&quot;,&quot;signUpUrl&quot;:&quot;/user/sign_up&quot;,&quot;signInWithReturnUrl&quot;:true,&quot;deployServices&quot;:[],&quot;defaultLogoAltText&quot;:&quot;Goodreads Home&quot;,&quot;mobviousDeviceType&quot;:&quot;desktop&quot;}"><header data-reactid=".23qldf5l1sc" data-react-checksum="1213851050"><div class="siteHeader__topFullImageContainer" style="background-color:#f0bf6e;" data-reactid=".23qldf5l1sc.0"><a class="siteHeader__topFullImageLink" href="https://www.goodreads.com/choiceawards/best-books-2024?ref=gca_dec_24_gcaw_eb" data-reactid=".23qldf5l1sc.0.0"><picture data-reactid=".23qldf5l1sc.0.0.0"><source media="(min-width: 768px)" srcset="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829440i/469.jpg 1x, https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829446i/470.jpg 2x" data-reactid=".23qldf5l1sc.0.0.0.0"/><img alt="Check out the winners of the 2024 Goodreads Choice Awards" class="siteHeader__topFullImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829452i/471.jpg" srcset="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/siteheaderbannerimages/1730829458i/472.jpg 2x" data-reactid=".23qldf5l1sc.0.0.0.1"/></picture></a></div><div class="siteHeader__topLine gr-box gr-box--withShadow" data-reactid=".23qldf5l1sc.1"><div class="siteHeader__contents" data-reactid=".23qldf5l1sc.1.0"><div class="siteHeader__topLevelItem siteHeader__topLevelItem--searchIcon" data-reactid=".23qldf5l1sc.1.0.0"><button class="siteHeader__searchIcon gr-iconButton" aria-label="Toggle search" type="button" data-ux-click="true" data-reactid=".23qldf5l1sc.1.0.0.0"></button></div><a href="/" class="siteHeader__logo" aria-label="Goodreads Home" title="Goodreads Home" data-reactid=".23qldf5l1sc.1.0.1"></a><nav class="siteHeader__primaryNavInline" data-reactid=".23qldf5l1sc.1.0.2"><ul role="menu" class="siteHeader__menuList" data-reactid=".23qldf5l1sc.1.0.2.0"><li class="siteHeader__topLevelItem siteHeader__topLevelItem--home" data-reactid=".23qldf5l1sc.1.0.2.0.0"><a href="/?ref=nav_home" class="siteHeader__topLevelLink" data-reactid=".23qldf5l1sc.1.0.2.0.0.0">Home</a></li><li class="siteHeader__topLevelItem" data-reactid=".23qldf5l1sc.1.0.2.0.1"><a href="/review/list?ref=nav_mybooks" class="siteHeader__topLevelLink" data-reactid=".23qldf5l1sc.1.0.2.0.1.0">My Books</a></li><li class="siteHeader__topLevelItem" data-reactid=".23qldf5l1sc.1.0.2.0.2"><div class="primaryNavMenu primaryNavMenu--siteHeaderBrowseMenu ignore-react-onclickoutside" data-reactid=".23qldf5l1sc.1.0.2.0.2.0"><a class="primaryNavMenu__trigger primaryNavMenu__trigger--siteHeaderBrowseMenu" href="/book?ref=nav_brws" role="button" aria-haspopup="true" aria-expanded="false" data-ux-click="true" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.0"><span data-reactid=".23qldf5l1sc.1.0.2.0.2.0.0.0">Browse ▾</span></a><div class="primaryNavMenu__menu gr-box gr-box--withShadowLarge wide" role="menu" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1"><div class="siteHeader__browseMenuDropdown" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0"><ul class="siteHeader__subNav" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0"><li role="menuitem Recommendations" class="menuLink" aria-label="Recommendations" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.0"><a href="/recommendations?ref=nav_brws_recs" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.0.0">Recommendations</a></li><li role="menuitem Choice Awards" class="menuLink" aria-label="Choice Awards" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.1"><a href="/choiceawards?ref=nav_brws_gca" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.1.0">Choice Awards</a></li><li role="menuitem Genres" class="menuLink" aria-label="Genres" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.2"><a href="/genres?ref=nav_brws_genres" class="siteHeader__subNavLink siteHeader__subNavLink--genresIndex" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.2.0">Genres</a></li><li role="menuitem Giveaways" class="menuLink" aria-label="Giveaways" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.3"><a href="/giveaway?ref=nav_brws_giveaways" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.3.0">Giveaways</a></li><li role="menuitem New Releases" class="menuLink" aria-label="New Releases" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.4"><a href="/book/popular_by_date/2024/12?ref=nav_brws_newrels" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.4.0">New Releases</a></li><li role="menuitem Lists" class="menuLink" aria-label="Lists" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.5"><a href="/list?ref=nav_brws_lists" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.5.0">Lists</a></li><li role="menuitem Explore" class="menuLink" aria-label="Explore" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.6"><a href="/book?ref=nav_brws_explore" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.6.0">Explore</a></li><li role="menuitem News &amp; Interviews" class="menuLink" aria-label="News &amp; Interviews" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.7"><a href="/news?ref=nav_brws_news" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.0.7.0">News &amp; Interviews</a></li></ul><div class="siteHeader__spotlight siteHeader__spotlight--withoutSubMenu" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1"><div class="genreListContainer" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0"><div class="siteHeader__heading siteHeader__title" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.0">Genres</div><ul class="genreList" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0"><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Art"><a href="/genres/art" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Art.0">Art</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Biography"><a href="/genres/biography" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Biography.0">Biography</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Business"><a href="/genres/business" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Business.0">Business</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Children&#x27;s"><a href="/genres/children-s" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Children&#x27;s.0">Children&#x27;s</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Christian"><a href="/genres/christian" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Christian.0">Christian</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Classics"><a href="/genres/classics" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Classics.0">Classics</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Comics"><a href="/genres/comics" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Comics.0">Comics</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Cookbooks"><a href="/genres/cookbooks" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Cookbooks.0">Cookbooks</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Ebooks"><a href="/genres/ebooks" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Ebooks.0">Ebooks</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Fantasy"><a href="/genres/fantasy" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList0.0:$Fantasy.0">Fantasy</a></li></ul><ul class="genreList" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1"><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Fiction"><a href="/genres/fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Fiction.0">Fiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Graphic Novels"><a href="/genres/graphic-novels" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Graphic Novels.0">Graphic Novels</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Historical Fiction"><a href="/genres/historical-fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Historical Fiction.0">Historical Fiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$History"><a href="/genres/history" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$History.0">History</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Horror"><a href="/genres/horror" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Horror.0">Horror</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Memoir"><a href="/genres/memoir" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Memoir.0">Memoir</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Music"><a href="/genres/music" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Music.0">Music</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Mystery"><a href="/genres/mystery" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Mystery.0">Mystery</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Nonfiction"><a href="/genres/non-fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Nonfiction.0">Nonfiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Poetry"><a href="/genres/poetry" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList1.0:$Poetry.0">Poetry</a></li></ul><ul class="genreList" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2"><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Psychology"><a href="/genres/psychology" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Psychology.0">Psychology</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Romance"><a href="/genres/romance" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Romance.0">Romance</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Science"><a href="/genres/science" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Science.0">Science</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Science Fiction"><a href="/genres/science-fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Science Fiction.0">Science Fiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Self Help"><a href="/genres/self-help" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Self Help.0">Self Help</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Sports"><a href="/genres/sports" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Sports.0">Sports</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Thriller"><a href="/genres/thriller" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Thriller.0">Thriller</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Travel"><a href="/genres/travel" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Travel.0">Travel</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Young Adult"><a href="/genres/young-adult" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.0:$Young Adult.0">Young Adult</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.1"><a href="/genres" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.2.0.2.0.1.0.1.0.1:$genreList2.1.0">More Genres</a></li></ul></div></div></div></div></div></li><li class="siteHeader__topLevelItem siteHeader__topLevelItem--community" data-reactid=".23qldf5l1sc.1.0.2.0.3"><div class="primaryNavMenu ignore-react-onclickoutside" data-reactid=".23qldf5l1sc.1.0.2.0.3.0"><a class="primaryNavMenu__trigger" href="/group?ref=nav_comm" role="button" aria-haspopup="true" aria-expanded="false" data-ux-click="true" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.0"><span data-reactid=".23qldf5l1sc.1.0.2.0.3.0.0.0">Community ▾</span></a><div class="primaryNavMenu__menu gr-box gr-box--withShadowLarge" role="menu" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1"><ul class="siteHeader__subNav" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0"><li role="menuitem Groups" class="menuLink" aria-label="Groups" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0.0"><a href="/group?ref=nav_comm_groups" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0.0.0">Groups</a></li><li role="menuitem Quotes" class="menuLink" aria-label="Quotes" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0.2"><a href="/quotes?ref=nav_comm_quotes" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0.2.0">Quotes</a></li><li role="menuitem Ask the Author" class="menuLink" aria-label="Ask the Author" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0.3"><a href="/ask_the_author?ref=nav_comm_askauthor" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.2.0.3.0.1.0.3.0">Ask the Author</a></li></ul></div></div></li></ul></nav><div accept-charset="UTF-8" class="searchBox searchBox--navbar" data-reactid=".23qldf5l1sc.1.0.3"><form autocomplete="off" action="/search" class="searchBox__form" role="search" aria-label="Search for books to add to your shelves" data-reactid=".23qldf5l1sc.1.0.3.0"><input class="searchBox__input searchBox__input--navbar" autocomplete="off" name="q" type="text" placeholder="Search books" aria-label="Search books" aria-controls="searchResults" data-reactid=".23qldf5l1sc.1.0.3.0.0"/><input type="hidden" name="qid" value="" data-reactid=".23qldf5l1sc.1.0.3.0.1"/><button type="submit" class="searchBox__icon--magnifyingGlass gr-iconButton searchBox__icon searchBox__icon--navbar" aria-label="Search" data-reactid=".23qldf5l1sc.1.0.3.0.2"></button></form></div><ul class="siteHeader__personal" data-reactid=".23qldf5l1sc.1.0.4"><li class="siteHeader__topLevelItem siteHeader__topLevelItem--signedOut" data-reactid=".23qldf5l1sc.1.0.4.0"><a href="/user/sign_in?returnurl=undefined" rel="nofollow" class="siteHeader__topLevelLink" data-reactid=".23qldf5l1sc.1.0.4.0.0">Sign In</a></li><li class="siteHeader__topLevelItem siteHeader__topLevelItem--signedOut" data-reactid=".23qldf5l1sc.1.0.4.1"><a href="/user/sign_up" rel="nofollow" class="siteHeader__topLevelLink" data-reactid=".23qldf5l1sc.1.0.4.1.0">Join</a></li></ul><div class="siteHeader__topLevelItem siteHeader__topLevelItem--signUp" data-reactid=".23qldf5l1sc.1.0.5"><a href="/user/sign_up" class="gr-button gr-button--dark" rel="nofollow" data-reactid=".23qldf5l1sc.1.0.5.0">Sign up</a></div><div class="modal modal--overlay modal--drawer" tabindex="0" data-reactid=".23qldf5l1sc.1.0.7"><div data-reactid=".23qldf5l1sc.1.0.7.0"><div class="modal__close" data-reactid=".23qldf5l1sc.1.0.7.0.0"><button type="button" class="gr-iconButton" data-reactid=".23qldf5l1sc.1.0.7.0.0.0"><img alt="Dismiss" src="//s.gr-assets.com/assets/gr/icons/icon_close_white-dbf4152deeef5bd3915d5d12210bf05f.svg" data-reactid=".23qldf5l1sc.1.0.7.0.0.0.0"/></button></div><div class="modal__content" data-reactid=".23qldf5l1sc.1.0.7.0.1"><div class="personalNavDrawer" data-reactid=".23qldf5l1sc.1.0.7.0.1.0"><div class="personalNavDrawer__personalNavContainer" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.0"><noscript data-reactid=".23qldf5l1sc.1.0.7.0.1.0.0.0"></noscript></div><div class="personalNavDrawer__profileAndLinksContainer" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1"><div class="personalNavDrawer__profileContainer gr-mediaFlexbox gr-mediaFlexbox--alignItemsCenter" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0"><div class="gr-mediaFlexbox__media" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0.0"><img class="circularIcon circularIcon--large circularIcon--border" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0.0.0"/></div><div class="gr-mediaFlexbox__desc" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0.1"><a class="gr-hyperlink gr-hyperlink--bold" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0.1.0"></a><div class="u-displayBlock" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0.1.1"><a class="gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.0.1.1.0">View profile</a></div></div></div><div class="personalNavDrawer__profileMenuContainer" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1"><ul data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0"><li role="menuitem Profile" class="menuLink" aria-label="Profile" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.0"><span data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.0.0"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.0.0.0">Profile</a></span></li><li role="menuitem Friends" class="menuLink" aria-label="Friends" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.3"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.3.0">Friends</a></li><li role="menuitem Groups" class="menuLink" aria-label="Groups" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.4"><span data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.4.0"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.4.0.0"><span data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.4.0.0.0">Groups</span></a></span></li><li role="menuitem Discussions" class="menuLink" aria-label="Discussions" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.5"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.5.0">Discussions</a></li><li role="menuitem Comments" class="menuLink" aria-label="Comments" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.6"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.6.0">Comments</a></li><li role="menuitem Reading Challenge" class="menuLink" aria-label="Reading Challenge" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.7"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.7.0">Reading Challenge</a></li><li role="menuitem Kindle Notes &amp; Highlights" class="menuLink" aria-label="Kindle Notes &amp; Highlights" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.8"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.8.0">Kindle Notes &amp; Highlights</a></li><li role="menuitem Quotes" class="menuLink" aria-label="Quotes" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.9"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.9.0">Quotes</a></li><li role="menuitem Favorite genres" class="menuLink" aria-label="Favorite genres" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.a"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.a.0">Favorite genres</a></li><li role="menuitem Friends&#x27; recommendations" class="menuLink" aria-label="Friends&#x27; recommendations" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.b"><span data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.b.0"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.b.0.0"><span data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.b.0.0.0">Friends’ recommendations</span></a></span></li><li role="menuitem Account settings" class="menuLink" aria-label="Account settings" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.c"><a class="siteHeader__subNavLink u-topGrayBorder" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.c.0">Account settings</a></li><li role="menuitem Help" class="menuLink" aria-label="Help" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.d"><a class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.d.0">Help</a></li><li role="menuitem Sign out" class="menuLink" aria-label="Sign out" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.e"><a class="siteHeader__subNavLink" data-method="POST" data-reactid=".23qldf5l1sc.1.0.7.0.1.0.1.1.0.e.0">Sign out</a></li></ul></div></div></div></div></div></div></div></div><div class="headroom-wrapper" data-reactid=".23qldf5l1sc.2"><div style="position:relative;top:0;left:0;right:0;z-index:1;-webkit-transform:translateY(0);-ms-transform:translateY(0);transform:translateY(0);" class="headroom headroom--unfixed" data-reactid=".23qldf5l1sc.2.0"><nav class="siteHeader__primaryNavSeparateLine gr-box gr-box--withShadow" data-reactid=".23qldf5l1sc.2.0.0"><ul role="menu" class="siteHeader__menuList" data-reactid=".23qldf5l1sc.2.0.0.0"><li class="siteHeader__topLevelItem siteHeader__topLevelItem--home" data-reactid=".23qldf5l1sc.2.0.0.0.0"><a href="/?ref=nav_home" class="siteHeader__topLevelLink" data-reactid=".23qldf5l1sc.2.0.0.0.0.0">Home</a></li><li class="siteHeader__topLevelItem" data-reactid=".23qldf5l1sc.2.0.0.0.1"><a href="/review/list?ref=nav_mybooks" class="siteHeader__topLevelLink" data-reactid=".23qldf5l1sc.2.0.0.0.1.0">My Books</a></li><li class="siteHeader__topLevelItem" data-reactid=".23qldf5l1sc.2.0.0.0.2"><div class="primaryNavMenu primaryNavMenu--siteHeaderBrowseMenu ignore-react-onclickoutside" data-reactid=".23qldf5l1sc.2.0.0.0.2.0"><a class="primaryNavMenu__trigger primaryNavMenu__trigger--siteHeaderBrowseMenu" href="/book?ref=nav_brws" role="button" aria-haspopup="true" aria-expanded="false" data-ux-click="true" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.0"><span data-reactid=".23qldf5l1sc.2.0.0.0.2.0.0.0">Browse ▾</span></a><div class="primaryNavMenu__menu gr-box gr-box--withShadowLarge wide" role="menu" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1"><div class="siteHeader__browseMenuDropdown" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0"><ul class="siteHeader__subNav" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0"><li role="menuitem Recommendations" class="menuLink" aria-label="Recommendations" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.0"><a href="/recommendations?ref=nav_brws_recs" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.0.0">Recommendations</a></li><li role="menuitem Choice Awards" class="menuLink" aria-label="Choice Awards" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.1"><a href="/choiceawards?ref=nav_brws_gca" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.1.0">Choice Awards</a></li><li role="menuitem Genres" class="menuLink" aria-label="Genres" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.2"><a href="/genres?ref=nav_brws_genres" class="siteHeader__subNavLink siteHeader__subNavLink--genresIndex" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.2.0">Genres</a></li><li role="menuitem Giveaways" class="menuLink" aria-label="Giveaways" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.3"><a href="/giveaway?ref=nav_brws_giveaways" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.3.0">Giveaways</a></li><li role="menuitem New Releases" class="menuLink" aria-label="New Releases" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.4"><a href="/book/popular_by_date/2024/12?ref=nav_brws_newrels" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.4.0">New Releases</a></li><li role="menuitem Lists" class="menuLink" aria-label="Lists" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.5"><a href="/list?ref=nav_brws_lists" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.5.0">Lists</a></li><li role="menuitem Explore" class="menuLink" aria-label="Explore" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.6"><a href="/book?ref=nav_brws_explore" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.6.0">Explore</a></li><li role="menuitem News &amp; Interviews" class="menuLink" aria-label="News &amp; Interviews" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.7"><a href="/news?ref=nav_brws_news" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.0.7.0">News &amp; Interviews</a></li></ul><div class="siteHeader__spotlight siteHeader__spotlight--withoutSubMenu" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1"><div class="genreListContainer" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0"><div class="siteHeader__heading siteHeader__title" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.0">Genres</div><ul class="genreList" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0"><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Art"><a href="/genres/art" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Art.0">Art</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Biography"><a href="/genres/biography" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Biography.0">Biography</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Business"><a href="/genres/business" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Business.0">Business</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Children&#x27;s"><a href="/genres/children-s" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Children&#x27;s.0">Children&#x27;s</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Christian"><a href="/genres/christian" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Christian.0">Christian</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Classics"><a href="/genres/classics" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Classics.0">Classics</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Comics"><a href="/genres/comics" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Comics.0">Comics</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Cookbooks"><a href="/genres/cookbooks" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Cookbooks.0">Cookbooks</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Ebooks"><a href="/genres/ebooks" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Ebooks.0">Ebooks</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Fantasy"><a href="/genres/fantasy" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList0.0:$Fantasy.0">Fantasy</a></li></ul><ul class="genreList" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1"><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Fiction"><a href="/genres/fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Fiction.0">Fiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Graphic Novels"><a href="/genres/graphic-novels" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Graphic Novels.0">Graphic Novels</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Historical Fiction"><a href="/genres/historical-fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Historical Fiction.0">Historical Fiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$History"><a href="/genres/history" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$History.0">History</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Horror"><a href="/genres/horror" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Horror.0">Horror</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Memoir"><a href="/genres/memoir" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Memoir.0">Memoir</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Music"><a href="/genres/music" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Music.0">Music</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Mystery"><a href="/genres/mystery" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Mystery.0">Mystery</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Nonfiction"><a href="/genres/non-fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Nonfiction.0">Nonfiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Poetry"><a href="/genres/poetry" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList1.0:$Poetry.0">Poetry</a></li></ul><ul class="genreList" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2"><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Psychology"><a href="/genres/psychology" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Psychology.0">Psychology</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Romance"><a href="/genres/romance" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Romance.0">Romance</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Science"><a href="/genres/science" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Science.0">Science</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Science Fiction"><a href="/genres/science-fiction" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Science Fiction.0">Science Fiction</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Self Help"><a href="/genres/self-help" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Self Help.0">Self Help</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Sports"><a href="/genres/sports" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Sports.0">Sports</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Thriller"><a href="/genres/thriller" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Thriller.0">Thriller</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Travel"><a href="/genres/travel" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Travel.0">Travel</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Young Adult"><a href="/genres/young-adult" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.0:$Young Adult.0">Young Adult</a></li><li role="menuitem" class="genreList__genre" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.1"><a href="/genres" class="genreList__genreLink gr-hyperlink gr-hyperlink--naked" data-reactid=".23qldf5l1sc.2.0.0.0.2.0.1.0.1.0.1:$genreList2.1.0">More Genres</a></li></ul></div></div></div></div></div></li><li class="siteHeader__topLevelItem siteHeader__topLevelItem--community" data-reactid=".23qldf5l1sc.2.0.0.0.3"><div class="primaryNavMenu ignore-react-onclickoutside" data-reactid=".23qldf5l1sc.2.0.0.0.3.0"><a class="primaryNavMenu__trigger" href="/group?ref=nav_comm" role="button" aria-haspopup="true" aria-expanded="false" data-ux-click="true" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.0"><span data-reactid=".23qldf5l1sc.2.0.0.0.3.0.0.0">Community ▾</span></a><div class="primaryNavMenu__menu gr-box gr-box--withShadowLarge" role="menu" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1"><ul class="siteHeader__subNav" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0"><li role="menuitem Groups" class="menuLink" aria-label="Groups" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0.0"><a href="/group?ref=nav_comm_groups" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0.0.0">Groups</a></li><li role="menuitem Quotes" class="menuLink" aria-label="Quotes" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0.2"><a href="/quotes?ref=nav_comm_quotes" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0.2.0">Quotes</a></li><li role="menuitem Ask the Author" class="menuLink" aria-label="Ask the Author" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0.3"><a href="/ask_the_author?ref=nav_comm_askauthor" class="siteHeader__subNavLink" data-reactid=".23qldf5l1sc.2.0.0.0.3.0.1.0.3.0">Ask the Author</a></li></ul></div></div></li></ul></nav></div></div></header></div> </div> <div class='siteHeaderBottomSpacer'></div> <div class="mainContentContainer "> <div class="mainContent "> <div id="premiumAdTop"> <div data-react-class="ReactComponents.GoogleBannerAd" data-react-props="{&quot;adId&quot;:&quot;&quot;,&quot;className&quot;:&quot;googleBannerAd--pushdown&quot;}"></div> </div> <div class="mainContentFloat "> <div id="flashContainer"> </div> <div class="leftContainer"> <div class="breadcrumbs"> <a href="/genres">Genres</a> &gt; <a href="/genres/non-fiction">Nonfiction</a> </div> <div class="genreHeader"> <h1 class="left"> History </h1> <div class="clear"></div> </div> <div class="mediumText reviewText"> <span id="freeTextContainer8037040279407061873">History (from Greek ἱστορία - historia, meaning &quot;inquiry, knowledge acquired by investigation&quot;) is the discovery, collection, organization, and presentation of information about past events. History can also mean the period of time after writing was invented. Scholars who write about history are called historians. It is a field of research which uses a narrative to examine and analyse the sequence of events, and it sometimes attempts to investigate objectively the patterns of cause and effect that determine events. Historians debate the nature of history and its usefulness. This includes discu</span> <span id="freeText8037040279407061873" style="display:none">History (from Greek ἱστορία - historia, meaning "inquiry, knowledge acquired by investigation") is the discovery, collection, organization, and presentation of information about past events. History can also mean the period of time after writing was invented. Scholars who write about history are called historians. It is a field of research which uses a narrative to examine and analyse the sequence of events, and it sometimes attempts to investigate objectively the patterns of cause and effect that determine events. Historians debate the nature of history and its usefulness. This includes discussing the study of the discipline as an end in itself and as a way of providing "perspective" on the problems of the present. The stories common to a particular culture, but not supported by external sources (such as the legends surrounding King Arthur) are usually classified as cultural heritage rather than the "disinterested investigation" needed by the discipline of history. Events of the past prior to written record are considered prehistory.<br />Amongst scholars, the fifth century BC Greek historian Herodotus is considered to be the "father of history", and, along with his contemporary Thucydides, forms the foundations for the modern study of history. Their influence, along with other historical traditions in other parts of their world, have spawned many different interpretations of the nature of history which has evolved over the centuries and are continuing to change. The modern study of history has many different fields including those that focus on certain regions and those which focus on certain topical or thematical elements of historical investigation. Often history is taught as part of primary and secondary education, and the academic study of history is a major discipline in University studies.</span> <a data-text-id="8037040279407061873" href="#" onclick="swapContent($(this));; return false;">...more</a> </div> <br/> <div class="coverBigBox clearFloats bigBox" show_header="true"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/genres/new_releases/history">New Releases Tagged &quot;History&quot;</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_207293782"> <a href="/book/show/207293782-didion-and-babitz"><img alt="Didion and Babitz" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1713508797l/207293782._SY475_.jpg" /></a> </div> <script type="text/javascript" charset="utf-8"> //<![CDATA[ function submitShelfLink(unique_id, book_id, shelf_id, shelf_name, submit_form, exclusive) { var checkbox_id = 'shelf_name_' + unique_id + '_' + shelf_id; var element = document.getElementById(checkbox_id) var checked = element.checked if (checked && exclusive) { // can't uncheck a radio by clicking it! return } if(document.getElementById("savingMessage")){ Element.show('savingMessage') } var element_id = 'shelfInDropdownName_' + unique_id + '_' + shelf_id; Element.update(element_id, "saving..."); if (submit_form) { Element.hide('shelfDropdown_' + unique_id) var form = document.getElementById('addBookForm' + book_id) if (form) { form.shelf.value = shelf_name form.onsubmit() } } else { var action = checked ? 'remove' : '' element.checked = !element.checked new Ajax.Request('/shelf/add_to_shelf', {asynchronous:true, evalScripts:true, onSuccess:function(request){shelfSubmitted(request, book_id, checkbox_id, element_id, unique_id, shelf_name)}, parameters:'book_id=' + book_id + '&name=' + shelf_name + '&a=' + action + '&authenticity_token=' + encodeURIComponent('RjC8GvAT7cYj6kD05egfDsBzPTR4xaxGQ8lCiV2T8FL4pICsuzrI76uPrd3lsW4tuK8VtwWzrLItSMbAV9UieA==')}) } } function shelfSubmitted(request, book_id, checkbox_id, element_id, unique_id, shelf_name) { Element.update('shelfListfalse_' + book_id, request.responseText) afterShelfSave(checkbox_id, element_id, unique_id, shelf_name.escapeHTML()) } function refreshGroupBox(group_id, book_id) { new Ajax.Updater('addGroupBooks' + book_id + '', '/group/add_book_box', {asynchronous:true, evalScripts:true, onSuccess:function(request){refreshGroupBoxComplete(request, book_id);}, parameters:'id=' + group_id + '&book_id=' + book_id + '&refresh=true' + '&authenticity_token=' + encodeURIComponent('iWOsPZJvuGSusmYezqSvY2o98bBpB/imitXFkrpEnBo395CL2UadTSbXizfO/d5AEuHZMxRx+FLkVEHbsAJOMA==')}) } //]]> </script> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_207293782'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/207293782-didion-and-babitz?from_choice=false&amp;from_home_module=false\">Didion and Babitz<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/8323980.Lili_Anolik\">Lili Anolik<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.31 avg rating &mdash; 512 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer9384323736851890730\"> Joan Didion is revealed at last in this outrageously provocative and profoundly moving new work on the mutual attractions—and mutual antipathies—of Didion and Didion’s fellow literary titan, Eve Babitz. “Could you write what you write if you weren’t so tiny, Joan?” —Eve Babitz, in a letter to Joan <\/span>\n <span id=\"freeText9384323736851890730\" style=\"display:none\"> Joan Didion is revealed at last in this outrageously provocative and profoundly moving new work on the mutual attractions—and mutual antipathies—of Didion and Didion’s fellow literary titan, Eve Babitz. “Could you write what you write if you weren’t so tiny, Joan?” —Eve Babitz, in a letter to Joan Didion, 1972 Eve Babitz died on December 17, 2021. Found in a closet in the back of an apartment full of wrack, ruin, and filth was a stack of boxes packed by her mother decades before. These boxes were pristine, the seals of duct tape unbroken. journals, photos, scrapbooks, manuscripts, letters. inside a lost world. This world turned for a certain number of years in the late sixties and early seventies, and was centered on a two-story house rented by Joan Didion and her husband, writer John Gregory Dunne, in a down-at-heel section of Hollywood. 7406 Franklin Avenue, a combination salon-hotbed-living end where writers and artists mixed with movie stars, rock n’ rollers, drug trash. 7406 Franklin Avenue was the making of one great American Joan Didion, cool and reserved behind her oversized sunglasses and storied marriage, a union as tortured as it was enduring. 7406 Franklin Avenue was the breaking and then the remaking—and thus the true making—of another great American Eve Babitz, goddaughter of Igor Stravinsky, nude of Marcel Duchamp, consort of Jim Morrison (among many, many others), who burned so hot she finally almost burned herself alive. The two formed a complicated a friendship that went bad, amity turning to enmity; a friendship that was as rare as true love, as rare as true hate. Didion, in spite of her confessional style, her widespread fame, is so little known or understood. She’s remained opaque, elusive. Until now. With deftness and skill, journalist Lili Anolik uses Babitz—Babitz’s brilliance of observation, Babitz’s incisive intelligence, and, most of all, Babitz’s diary-like letters—as the key to unlocking the mighty and mysterious Didion.<\/span>\n <a data-text-id=\"9384323736851890730\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_207293782').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_207293782').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_207293782').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_207293782').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_208430625"> <a href="/book/show/208430625-vanishing-treasures"><img alt="Vanishing Treasures: A Bestiary of Extraordinary Endangered Creatures" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1715016407l/208430625.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_208430625'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/208430625-vanishing-treasures?from_choice=false&amp;from_home_module=false\">Vanishing Treasures: A Bestiary of Extraordinary Endangered Creatures<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/4511275.Katherine_Rundell\">Katherine Rundell<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.18 avg rating &mdash; 521 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer2632206273230648549\">From the award-winning author Katherine Rundell comes a “rare and magical book” (Bill Bryson) reckoning with the vanishing wonders of our natural world.\n\nThe world is more astonishing, more miraculous, and more wonderful than our wildest imaginings. In this brilliant and passionately persuasive book<\/span>\n <span id=\"freeText2632206273230648549\" style=\"display:none\">From the award-winning author Katherine Rundell comes a “rare and magical book” (Bill Bryson) reckoning with the vanishing wonders of our natural world.\n\nThe world is more astonishing, more miraculous, and more wonderful than our wildest imaginings. In this brilliant and passionately persuasive book, Katherine Rundell takes us on a globe-spanning tour of the world\'s most awe-inspiring animals currently facing extinction.\n\nConsider the seahorse: couples mate for life and meet each morning for a dance, pirouetting and changing colors before going their separate ways, to dance again the next day. The American wood frog survives winter by allowing itself to freeze solid, its heartbeat slowing until it stops altogether. Come spring, the heart kick-starts itself spontaneously back to life. As for the lemur, it lives in matriarchal troops led by an alpha female (it’s not unusual for female ring-tailed lemurs to slap males across the face when they become aggressive). Whenever they are cold or frightened, they group together in what’s known as a lemur ball, paws and tails intertwined, to form a furry mass as big as a bicycle wheel.\n\nBut each of these extraordinary animals is endangered or holds a sub-species that is endangered. This urgent, inspiring book of essays dedicated to 23 unusual and underappreciated creatures is a clarion call insisting that we look at the world around us with new eyes—to see the magic of the animals we live among, their unknown histories and capabilities, and above all how lucky we are to tread the same ground as such vanishing treasures.\n\nBeautifully illustrated, and full of inimitable wit and intellect, Vanishing Treasures is a chance to be awestruck and lovestruck, to reckon with the beauty of the world, its fragility, and its strangeness.<\/span>\n <a data-text-id=\"2632206273230648549\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_208430625').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_208430625').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_208430625').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_208430625').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_203578727"> <a href="/book/show/203578727-cabinet-of-curiosities"><img alt="Cabinet of Curiosities: A Historical Tour of the Unbelievable, the Unsettling, and the Bizarre" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1714079076l/203578727._SX318_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_203578727'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/203578727-cabinet-of-curiosities?from_choice=false&amp;from_home_module=false\">Cabinet of Curiosities: A Historical Tour of the Unbelievable, the Unsettling, and the Bizarre<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/4747781.Aaron_Mahnke\">Aaron Mahnke<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.87 avg rating &mdash; 275 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer10038695988089001061\">The new book based on the long-running hit podcast by Aaron Mahnke, which has translated into over 120-million downloads to date, and a monthly average of over 2 million listeners. \n\nThe podcast, Aaron Mahnke’s Cabinet of Curiosities, has delighted millions of listeners for years with tales of the w<\/span>\n <span id=\"freeText10038695988089001061\" style=\"display:none\">The new book based on the long-running hit podcast by Aaron Mahnke, which has translated into over 120-million downloads to date, and a monthly average of over 2 million listeners. \n\nThe podcast, Aaron Mahnke’s Cabinet of Curiosities, has delighted millions of listeners for years with tales of the wonderful, astounding, and downright bizarre people, places, and things throughout history. Now, in Cabinet of Curiosities the book, learn the fascinating story of the invention of the croissant in a country that was not France, and relive the adventures of a dog that stowed away and went to war, only to help capture a German spy. Along the way, readers will pass through the American state of Franklin, watch Abraham Lincoln’s son be rescued by his assassin’s brother, and learn how too many crash landings inspired one pilot to leave the airline industry and trek for the stars. \n\nFor the first time ever, Aaron has gathered scores of his favorites in print, and curated them into a beautiful, topical collection for devoted followers and new fans alike.<\/span>\n <a data-text-id=\"10038695988089001061\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_203578727').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_203578727').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_203578727').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_203578727').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_210594739"> <a href="/book/show/210594739-the-dead-of-winter"><img alt="The Dead of Winter: Beware the Krampus and Other Wicked Christmas Creatures" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1718924796l/210594739._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_210594739'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/210594739-the-dead-of-winter?from_choice=false&amp;from_home_module=false\">The Dead of Winter: Beware the Krampus and Other Wicked Christmas Creatures<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/23303329.Sarah_Clegg\">Sarah Clegg<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.78 avg rating &mdash; 408 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer17675151328772854580\">Enter the dark side of discover the monsters, witches, and nightmarish traditions behind one of the most celebrated holidays in the world When we imagine the origins of Christmas, we picture halcyon images of mangers, glowing fireplaces, and snow-blanketed winter hills. But the holiday is celebrated<\/span>\n <span id=\"freeText17675151328772854580\" style=\"display:none\">Enter the dark side of discover the monsters, witches, and nightmarish traditions behind one of the most celebrated holidays in the world When we imagine the origins of Christmas, we picture halcyon images of mangers, glowing fireplaces, and snow-blanketed winter hills. But the holiday is celebrated during the darkest time of year in the Northern Hemisphere—a season so dark it has given rise to the most outlandish traditions imaginable. In The Dead of Winter, Oxford-trained historian Sarah Clegg delves deep into the folkloric roots of Christmas in Europe, comparing their often-horrific past to the way they continue to haunt and entertain us now in the 21st century. Detailing the hideous masks and curling horns of &quot;Krampus runs&quot; in Austria, the fearsome horseheads of &quot;hoodenings&quot; in Southeast England, and the candle-crowned young witches of Finland\'s St. Lucy Festival, the author captures the wild revelry at heart of the winter madness.   In Clegg’s fascinating investigation, these strange, wonderful traditions are cast in their illuminating historical context. And the closer we get to the dark magic and bright enchantment described in The Dead of Winter, the more we start to see how fun it might be to let just a bit of the ancient darkness in.<\/span>\n <a data-text-id=\"17675151328772854580\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_210594739').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_210594739').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_210594739').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_210594739').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_208430671"> <a href="/book/show/208430671-believe"><img alt="Believe: The Untold Story Behind Ted Lasso, the Show That Kicked Its Way into Our Hearts" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1713974886l/208430671._SX318_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_208430671'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/208430671-believe?from_choice=false&amp;from_home_module=false\">Believe: The Untold Story Behind Ted Lasso, the Show That Kicked Its Way into Our Hearts<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/48522269.Jeremy_Egner\">Jeremy Egner<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.10 avg rating &mdash; 250 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer15593562870194951709\">The definitive book on the TV show Ted Lasso, written by New York Times journalist and editor Jeremy Egner, celebrating the show’s improbable rise and cultural impact while never losing sight of the heart, friendship, and passion that have made it an enduring favorite for the ages When Ted Lasso fir<\/span>\n <span id=\"freeText15593562870194951709\" style=\"display:none\">The definitive book on the TV show Ted Lasso, written by New York Times journalist and editor Jeremy Egner, celebrating the show’s improbable rise and cultural impact while never losing sight of the heart, friendship, and passion that have made it an enduring favorite for the ages When Ted Lasso first aired in 2020, nobody—including those who had worked on it—knew how a show inspired by an ad, centered around soccer, filled mostly with unknown actors, and led by a wondrously mustached “nice guy” would be received. Now, eleven Emmys and one Peabody Award later, it’s safe to say that the show’s status as a pop culture phenomenon is secure. And, for the first time, New York Times television editor Jeremy Egner explores the creation, production, and potent legacy of Ted Lasso. Drawing on dozens of interviews from key cast, creators, and more, Believe takes readers from the very first, silly NBC Premier League commercial to the pitch to Apple executives, then into the show’s writer’s room, through the brilliant international casting, and on to the unforgettable set and locations of the show itself.   Egner approaches his reporting as a journalist and as a cultural critic, but also with an affection and admiration fans will appreciate, carefully and humorously telling Ted Lasso’s story of teamwork, of hidden talent, of a group of friends looking around at the world’s increasingly nasty discourse and deciding that maybe simple decency still had the power to bring us together—a story about what happens when you dare to believe.<\/span>\n <a data-text-id=\"15593562870194951709\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_208430671').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_208430671').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_208430671').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_208430671').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_208894905"> <a href="/book/show/208894905-the-memory-palace"><img alt="The Memory Palace: True Short Stories of the Past" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1718894981l/208894905._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_208894905'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/208894905-the-memory-palace?from_choice=false&amp;from_home_module=false\">The Memory Palace: True Short Stories of the Past<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/9791157.Nate_DiMeo\">Nate DiMeo<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><\/span> 4.64 avg rating &mdash; 100 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer8990091073952168560\">A vivid collection of surprising true stories that brings to life long-forgotten icons, heroes who never got their due, and ordinary people who never made it to the history books, from the creator of the popular podcast The Memory Palace. What was Dreamland, Brooklyn&apos;s most popular attraction, like <\/span>\n <span id=\"freeText8990091073952168560\" style=\"display:none\">A vivid collection of surprising true stories that brings to life long-forgotten icons, heroes who never got their due, and ordinary people who never made it to the history books, from the creator of the popular podcast The Memory Palace. What was Dreamland, Brooklyn\'s most popular attraction, like before it burned down? Whatever happened to Shipwreck Kelly? What were the glistening orbs John Glenn saw from his capsule on his first trip to space? For more than a decade, Nate DiMeo has brought the big and small of American history to life in The Memory Palace, a podcast of crystalline short stories that are all completely true. In this beautifully designed collection, where DiMeo takes advantage of the visual form of a book by creating striking juxtapositions between images and text, he gathers the best of the show and adds brand-new stories exclusive to the book, which especially take their inspiration from photographs and the emergence of photography. The collection adds up to a unique take on the past that asks what gets to count as history in the first place, draws deep meaning from forgotten lives, and often dives into past crazes and the sometimes humorous and sometimes devastating fact that what or who is popular in one moment can become a barely remembered curiosity in the next. He resurrects stories that deserve to be memorialized, like that of the Surfmen of the Outer Banks who saved countless sailors\' lives and the workers who risked theirs daily to dig the base of the Brooklyn Bridge.  Each one of these poignant, vivid stories brings the past completely alive with the potential to shift our perspectives on the world today and to send readers out searching for all of the hidden stories it contains, just beyond the surface.<\/span>\n <a data-text-id=\"8990091073952168560\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_208894905').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_208894905').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_208894905').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_208894905').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_203578750"> <a href="/book/show/203578750-her-lotus-year"><img alt="Her Lotus Year: China, the Roaring Twenties, and the Making of Wallis Simpson" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1714078725l/203578750._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_203578750'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/203578750-her-lotus-year?from_choice=false&amp;from_home_module=false\">Her Lotus Year: China, the Roaring Twenties, and the Making of Wallis Simpson<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/34335.Paul_French\">Paul French<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.64 avg rating &mdash; 72 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer13589808963501413066\">New York Times bestselling author Paul French examines a controversial and revealing period in the early life of the legendary Wallis, Duchess of Windsor–her one year in China.\n\nBefore she was the Duchess of Windsor, Bessie Wallis Warfield was Mrs. Wallis Spencer, wife of Earl “Win” Spencer, a US Na<\/span>\n <span id=\"freeText13589808963501413066\" style=\"display:none\">New York Times bestselling author Paul French examines a controversial and revealing period in the early life of the legendary Wallis, Duchess of Windsor–her one year in China.\n\nBefore she was the Duchess of Windsor, Bessie Wallis Warfield was Mrs. Wallis Spencer, wife of Earl “Win” Spencer, a US Navy aviator. From humble beginnings in Baltimore, she rose to marry a man who gave up his throne for her. But what made Wallis Spencer, Navy Wife, the woman who could become the Duchess of Windsor? The answers lie in her one-year sojourn in China.\n\nIn her memoirs, Wallis described her time in China as her “Lotus Year,” referring to Homer’s Lotus Eaters, a group living in a state of dreamy forgetfulness, never to return home. Though faced with challenges, Wallis came to appreciate traditional Chinese aesthetics. China molded her in terms of her style and provided her with friendships that lasted a lifetime. But that “Lotus Year” would also later be used to damn her in the eyes of the British Establishment.\n\nThe British government’s supposed “China Dossier” of Wallis’s rumored amorous and immoral activities in the Far East was a damning concoction, portraying her as sordid, debauched, influenced by foreign agents, and unfit to marry a king. Instead, French, an award-winning China historian, reveals Wallis Warfield Spencer as a woman of tremendous courage who may have acted as a courier for the US government, undertaking dangerous undercover diplomatic missions in a China torn by civil war. \n\nHer Lotus Year is an untold story in the colorful life of a woman too often maligned by history.<\/span>\n <a data-text-id=\"13589808963501413066\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_203578750').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_203578750').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_203578750').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_203578750').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_205478785"> <a href="/book/show/205478785-ingenious"><img alt="Ingenious: A Biography of Benjamin Franklin, Scientist" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1713008788l/205478785._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_205478785'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/205478785-ingenious?from_choice=false&amp;from_home_module=false\">Ingenious: A Biography of Benjamin Franklin, Scientist<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/7279021.Richard_Munson\">Richard Munson<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.45 avg rating &mdash; 98 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer7020093543308722694\">The dramatic story of an ingenious man who explained nature and created a country.\n\nBenjamin Franklin was one of the preeminent scientists of his time. Driven by curiosity, he conducted cutting-edge research on electricity, heat, ocean currents, weather patterns, chemical bonds, and plants. But toda<\/span>\n <span id=\"freeText7020093543308722694\" style=\"display:none\">The dramatic story of an ingenious man who explained nature and created a country.\n\nBenjamin Franklin was one of the preeminent scientists of his time. Driven by curiosity, he conducted cutting-edge research on electricity, heat, ocean currents, weather patterns, chemical bonds, and plants. But today, Franklin is remembered more for his political prowess and diplomatic achievements than his scientific creativity.\n\nIn Ingenious, Richard Munson recovers this vital part of Franklin’s story, reveals his modern relevance, and offers a compelling portrait of a shrewd experimenter, clever innovator, and visionary physicist whose fame opened doors to negotiate French support and funding for American independence. Munson’s riveting narrative explores how science underpins Franklin’s entire story—from tradesman to inventor to nation-founder.<\/span>\n <a data-text-id=\"7020093543308722694\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_205478785').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_205478785').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_205478785').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_205478785').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_214363953"> <a href="/book/show/214363953-cher"><img alt="Cher: The Memoir, Part One" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1721750275l/214363953._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_214363953'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/214363953-cher?from_choice=false&amp;from_home_module=false\">Cher: The Memoir, Part One<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/150577.Cher\">Cher<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.41 avg rating &mdash; 2,264 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer159950662515980968\">THERE IS ONLY ONE CHER …\n\n… and for seven decades she has been showing us why. Cher holds the attention of the world with her voice, her acting, her style, her wit and her unstoppable spirit. Now, for the first time, she tells her story in her own voice – as honest as it is hilarious, as powerful as<\/span>\n <span id=\"freeText159950662515980968\" style=\"display:none\">THERE IS ONLY ONE CHER …\n\n… and for seven decades she has been showing us why. Cher holds the attention of the world with her voice, her acting, her style, her wit and her unstoppable spirit. Now, for the first time, she tells her story in her own voice – as honest as it is hilarious, as powerful as it is perceptive.\n\nCher’s childhood was anything but normal. As her mother Georgia – blessed with movie-star looks and a knockout voice – moved them around the country over and again in the hope of finding fame, her school life wasn’t straightforward. But she always knew she was going to be somebody when she grew up.\n\nCher’s powerful instinct to keep moving eventually landed her in the arms of Sonny Bono. The duo became famous beyond their wildest dreams, from humble beginnings singing backup in Phil Spector’s studio through to pop stardom as Sonny and Cher, and then on to the television show that made them household names. But as time passed, fame changed the dynamic of their relationship and Cher evolved from a wide-eyed teenager into a woman. She started fighting for herself, breaking away from Sonny’s control – and realising that things were not as they seemed.\n\nTaking risks, making headlines, falling in love, Cher struggled and stumbled while trying to become her own woman. The Memoir, Part One brings us to the brink of her next chapter, as she begins to chart her own path, finally claiming her rightful place in the world and becoming CHER.<\/span>\n <a data-text-id=\"159950662515980968\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_214363953').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_214363953').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_214363953').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_214363953').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_207611500"> <a href="/book/show/207611500-we-who-wrestle-with-god"><img alt="We Who Wrestle with God: Perceptions of the Divine" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1707192021l/207611500._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_207611500'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/207611500-we-who-wrestle-with-god?from_choice=false&amp;from_home_module=false\">We Who Wrestle with God: Perceptions of the Divine<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/282885.Jordan_B_Peterson\">Jordan B. Peterson<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.77 avg rating &mdash; 283 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer6726402959270672811\">A revolutionary new offering from Dr. Jordan B. Peterson, renowned psychologist and author of the global bestseller 12 Rules for Life.In We Who Wrestle with God, Dr. Peterson guides us through the ancient, foundational stories of the Western world. In riveting detail, he analyzes the Biblical accoun<\/span>\n <span id=\"freeText6726402959270672811\" style=\"display:none\">A revolutionary new offering from Dr. Jordan B. Peterson, renowned psychologist and author of the global bestseller 12 Rules for Life.In We Who Wrestle with God, Dr. Peterson guides us through the ancient, foundational stories of the Western world. In riveting detail, he analyzes the Biblical accounts of rebellion, sacrifice, suffering, and triumph that stabilize, inspire, and unite us culturally and psychologically. Adam and Eve and the eternal fall of mankind; the resentful and ultimately murderous war of Cain and Abel; the cataclysmic flood of Noah; the spectacular collapse of the Tower of Babel; Abraham’s terrible adventure; and the epic of Moses and the Israelites.  What could such stories possibly mean? What force wrote and assembled them over the long centuries? How did they bring our spirits and the world together, and point us in the same direction?  It is time for us to understand such things, scientifically and spiritually; to become conscious of the structure of our souls and our societies; and to see ourselves and others as if for the first time.   Join Elijah as he discovers the Voice of God in the dictates of his own conscience and Jonah confronting hell itself in the belly of the whale because he failed to listen and act. Set yourself straight in intent, aim, and purpose as you begin to more deeply understand the structure of your society and your soul. Journey with Dr. Peterson through the greatest stories ever told.  Dare to wrestle with God.<\/span>\n <a data-text-id=\"6726402959270672811\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_207611500').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_207611500').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_207611500').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_207611500').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_209456058"> <a href="/book/show/209456058-lincoln-vs-davis"><img alt="Lincoln vs. Davis: The War of the Presidents" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1710084962l/209456058._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_209456058'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/209456058-lincoln-vs-davis?from_choice=false&amp;from_home_module=false\">Lincoln vs. Davis: The War of the Presidents<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/73331.Nigel_Hamilton\">Nigel Hamilton<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.97 avg rating &mdash; 37 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer6166280261457948154\">From renowned biographer­­­ Nigel Hamilton, author of the epic FDR at War trilogy and the bestselling Reckless Youth, comes the greatest untold story of the Civil how two American presidents faced off as the fate of the nation hung in the balance — and how Abraham Lincoln came to embrace emancipatio<\/span>\n <span id=\"freeText6166280261457948154\" style=\"display:none\">From renowned biographer­­­ Nigel Hamilton, author of the epic FDR at War trilogy and the bestselling Reckless Youth, comes the greatest untold story of the Civil how two American presidents faced off as the fate of the nation hung in the balance — and how Abraham Lincoln came to embrace emancipation as the last, best chance to save the Union. Of all the books written on Abraham Lincoln, there has been one surprising the drama of how the “railsplitter” from Illinois grew into his critical role as U.S. commander-in-chief, and managed to outwit his formidable opponent, Jefferson Davis, in what remains history\'s only military faceoff between rival American presidents. Davis was a trained soldier and war hero; Lincoln a country lawyer who had only briefly served in the militia. Confronted with the most violent and challenging war ever seen on American soil, Lincoln seemed ill-suited to the inexperienced, indecisive, and a poor judge of people’s motives, he allowed his administration\'s war policies to be sabotaged by fickle, faithless cabinet officials while entrusting command of his army to a preening young officer named George McClellan – whose defeat in battle left Washington, the nation’s capital, at the mercy of General Robert E. Lee, Davis’s star performer.   The war almost ended there. But in a Shakespearean twist, Lincoln summoned the courage to make, at last, a climactic issuing as a “military necessity” a proclamation freeing the 3.5 million enslaved Americans without whom the South could not feed or fund their armed insurrection. The new war policy doomed the rebellion—which was in dire need of support from Europe, none of whose governments now would dare to recognize rebel “independence” in a war openly fought over slavery. The fate of President Davis was sealed.   With a cast of unforgettable characters, from first ladies to fugitive coachmen to treasonous cabinet officials, Lincoln vs. Davis is a spellbinding dual biography from renowned presidential chronicler Nigel a saga that will surprise, touch, and enthrall.  <\/span>\n <a data-text-id=\"6166280261457948154\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_209456058').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_209456058').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_209456058').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_209456058').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_210240758"> <a href="/book/show/210240758-ghosts-of-panama"><img alt="Ghosts of Panama: A Strongman Out of Control, A Murdered Marine, and the Special Agents Caught in the Middle of an Invasion" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1718919423l/210240758._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_210240758'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/210240758-ghosts-of-panama?from_choice=false&amp;from_home_module=false\">Ghosts of Panama: A Strongman Out of Control, A Murdered Marine, and the Special Agents Caught in the Middle of an Invasion<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/49599096.Mark_Harmon\">Mark Harmon<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.06 avg rating &mdash; 67 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer2474894891954182832\">Panama, 1989. The once warm relationship between United States and Gen. Manuel Noriega has eroded dangerously. Newly elected President George Bush has declared the strongman a drug trafficker and a rigger of elections. Intimidation on the streets is a daily reality for U.S. personnel and their famil<\/span>\n <span id=\"freeText2474894891954182832\" style=\"display:none\">Panama, 1989. The once warm relationship between United States and Gen. Manuel Noriega has eroded dangerously. Newly elected President George Bush has declared the strongman a drug trafficker and a rigger of elections. Intimidation on the streets is a daily reality for U.S. personnel and their families. The nation is a powder keg. \n \nNaval Investigative Service (NIS) Special Agent Rick Yell has worked the job in Panama since 1986, and lives there with his wife Annya and infant child. Like most NIS agents, he’s a civilian with no military rank with a specialty in working criminal cases. The dynamic changes suddenly when Yell inadvertently develops an intelligence source with unparalleled access to the Noriega regime. Now the agent is thrust into a world of spy-versus-spy, of secret meetings and hidden documents. \n \nYell’s source – known as “The Old Man” – warns when Cuban military personnel arrive and identifies anti-American officers within the Panamanian Defense Forces, provides information about an imprisoned CIA asset and helps track Noriega’s movements, agitating for the dictator’s kidnapping. The reports created by Yell and his NIS colleagues shape the decisions made in Washington D.C., CIA headquarters in Langley and the innermost sanctums of Pentagon.\n \nThe powder keg is lit on December 16, 1989, when a young U.S. Marine is gunned down at a checkpoint in Panama City. Yell and his cadre of trusted agents deploy immediately to investigate the killing, and what they determine will decide the fate of two nations. When President Bush hears the details they uncover, he orders an invasion that puts Yell’s family, informants and fellow agents directly in harm’s way. \n \nUsing a blend of research and interviews with the NIS agents who were directly involved, Ghosts of Panama reveals the untold, clandestine story of counterintelligence professionals placed in a pressure cooker assignment of historic proportions.<\/span>\n <a data-text-id=\"2474894891954182832\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_210240758').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_210240758').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_210240758').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_210240758').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_211051402"> <a href="/book/show/211051402-unfortunately-she-was-a-nymphomaniac"><img alt="Unfortunately, She was a Nymphomaniac: A New History of Rome&#39;s Imperial Women" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1718939296l/211051402._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_211051402'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/211051402-unfortunately-she-was-a-nymphomaniac?from_choice=false&amp;from_home_module=false\">Unfortunately, She was a Nymphomaniac: A New History of Rome&#39;s Imperial Women<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/59451.Joan_Smith\">Joan Smith<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.89 avg rating &mdash; 27 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer13670016405688858915\">Writer, activist and journalist Joan Smith has worked for years to raise awareness of violence against women and girls. And has been instrumental in bringing the innate misogyny of the police to public attention. Her new book will reinterpret the bloody, violent story of imperial women at the hands <\/span>\n <span id=\"freeText13670016405688858915\" style=\"display:none\">Writer, activist and journalist Joan Smith has worked for years to raise awareness of violence against women and girls. And has been instrumental in bringing the innate misogyny of the police to public attention. Her new book will reinterpret the bloody, violent story of imperial women at the hands of (in no particular order) Nero, Augustus, Tiberius, Caligula – and others. These imperial mothers, daughters and wives – were the most privileged women of their time but their lives were overshadowed, dominated and controlled by these men. Raped, killed, ripped apart from their children, and mostly airbrushed from history, Joan Smith brings these women back into light and into focus, offering an account of their extraordinary and tragic lives.\n\nIn Unfortunately, She was a Nymphomaniac, Smith pieces together the stories of these women, showing how they struggled for control of their lives at a time when both the law and culture were stacked against them. It is not a conventional history but an interpretation of the original texts informed by what we know now about the mechanics of domestic abuse. There are no ‘nymphomaniacs’ here but the picture that emerges is one of spirited, inspiring and sometimes reckless resistance to male authority. The way these women have been misrepresented for two thousand years speaks volumes not just about ancient misogyny, but the origin and persistence of attitudes that continue to blight women’s lives today.<\/span>\n <a data-text-id=\"13670016405688858915\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_211051402').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_211051402').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_211051402').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_211051402').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_203647815"> <a href="/book/show/203647815-the-lost-world-of-the-dinosaurs"><img alt="The Lost World of the Dinosaurs: Uncovering the Secrets of the Prehistoric Age" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1719784993l/203647815._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_203647815'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/203647815-the-lost-world-of-the-dinosaurs?from_choice=false&amp;from_home_module=false\">The Lost World of the Dinosaurs: Uncovering the Secrets of the Prehistoric Age<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/2123782.Armin_Schmitt\">Armin Schmitt<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.96 avg rating &mdash; 49 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer8340711024653114599\">An enrapturing tale of the age of the dinosaurs, tracing their earliest origins, their astounding two-hundred-million-year reign and their infamous demise Dinosaurs. No other class of animals captures the hearts of both children and adults alike. Paleontologist Armin Schmitt brings us a firsthand ac<\/span>\n <span id=\"freeText8340711024653114599\" style=\"display:none\">An enrapturing tale of the age of the dinosaurs, tracing their earliest origins, their astounding two-hundred-million-year reign and their infamous demise Dinosaurs. No other class of animals captures the hearts of both children and adults alike. Paleontologist Armin Schmitt brings us a firsthand account of the latest research on dinosaurs and their lives millions of years ago, including his spectacular global excavations and fascinating discoveries in the field. With the help of cutting-edge technology and unbelievable new finds, the age-old tale of the dinosaurs is now revitalized for the very first time, complete with astonishing illustrations by Ben Rennen that help us imagine dinosaurs like never before. Though we’re all familiar with popular dinosaurs such as the renowned Tyrannosaurus rex—every dino fan’s favorite—Schmitt answers the questions we’ve all been asking, such What is excavating at a dig site like? Why did birds survive the Great Dying, unlike the rest of the dinosaurs? How has the field of paleontology changed since the Bone Wars? Does climate change and its effects on the dinosaurs’ survival compare to our current climate crisis today?The Lost World of the Dinosaurs is an all-encompassing exploration traveling back in time into the world of the primeval giants, perfect for anyone interested in the largest land creatures that ever inhabited Earth.<\/span>\n <a data-text-id=\"8340711024653114599\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_203647815').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_203647815').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_203647815').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_203647815').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover684041_203579050"> <a href="/book/show/203579050-steel-lobsters"><img alt="Steel Lobsters: Crown, Commonwealth, and the Last Knights in England" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1719783816l/203579050._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover684041_203579050'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/203579050-steel-lobsters?from_choice=false&amp;from_home_module=false\">Steel Lobsters: Crown, Commonwealth, and the Last Knights in England<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/804399.Myke_Cole\">Myke Cole<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.56 avg rating &mdash; 18 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer4607219970143181658\">A dramatic history of the Steel Lobsters, Sir Arthur Hesilrige&apos;s Regiment of Horse, in the English Civil War – the last fully armoured knights in England. \n \n\n \nThe 17th-century battlefield ushered in a new era, with formed musketeers and pistol-wielding cavalry gradually taking over from the knig<\/span>\n <span id=\"freeText4607219970143181658\" style=\"display:none\">A dramatic history of the Steel Lobsters, Sir Arthur Hesilrige\'s Regiment of Horse, in the English Civil War – the last fully armoured knights in England. \n \n\n \nThe 17th-century battlefield ushered in a new era, with formed musketeers and pistol-wielding cavalry gradually taking over from the knights and men-at-arms that had dominated the European battlefield. Based on a detailed study of the primary sources, Steel Lobsters tells the story of this transition through the history of the last fully armoured knights in England. Myke Cole, an award-winning novelist, historian, and veteran, examines the life and times of Sir Arthur Hesilrige and his Regiment of Horse, known as \'the Lobsters\' as they were encased in plate armour. Steel Lobsters covers the full history of England\'s last knights, from the seeds of their creation in Hesilrige\'s experience as a young cavalry officer, to their final defeat at Roundway Down in July 1643, and the decision to abandon their armour. It provides lavish detail on arms, armour, and tactics, but also covers the human story of Sir Arthur Hesilrige, the men who served under him, and even those who opposed him. The story of this amazing unit is the story of the end of super-heavy cavalry, and this book delves into how wars were fought in the 17th century, the personalities, politics, and even spiritual beliefs of the combatants, how they fought, and why they ultimately lost.\n \n \n<\/span>\n <a data-text-id=\"4607219970143181658\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover684041_203579050').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover684041_203579050').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover684041_203579050').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover684041_203579050').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="clear"></div> <div class="moreLink"> <a class="actionLink" href="/genres/new_releases/history">More new releases tagged &quot;history&quot;...</a> </div> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/giveaway/genre/history">Giveaways</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="giveawayList"> <li class="listElement giveawayListItem"> <div class="giveawayPreviewBookContainer"> <div class="coverImage"> <a href="/book/show/203608467-the-1619-project"><img alt="The 1619 Project by Nikole Hannah-Jones" title="The 1619 Project by Nikole Hannah-Jones" width="90" class="bookCover" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1716910831l/203608467._SX98_.jpg" /></a> </div> <div class="description descriptionContainer"> <a class="bookTitle" href="https://www.goodreads.com/book/show/203608467-the-1619-project">The 1619 Project: A Visual Experience</a> <br/> <div id="bookAuthors" class=""> <span class='by'>by</span> <span itemprop='author' itemscope='' itemtype='http://schema.org/Person'> <div class='authorName__container'> <a class="authorName" itemprop="url" href="https://www.goodreads.com/author/show/6577870.Nikole_Hannah_Jones"><span itemprop="name">Nikole Hannah-Jones</span></a>, </div> <div class='authorName__container'> <a class="authorName" itemprop="url" href="https://www.goodreads.com/author/show/29982955.The_New_York_Times_Magazine"><span itemprop="name">The New York Times Magazine</span></a> </div> </span> </div> <br/> <div class="greyText releaseDate">Release date: Oct 22, 2024</div> <div class="giveawayDescriptionDetails"> <span id="freeTextContainer17435021734206715912"><b>An illustrated edition of <i>The 1619 Project</i>, with newly commissioned artwork and archival images, <i>The New York Times Magazine</i>&apos;s award-winning reframing</b></span> <span id="freeText17435021734206715912" style="display:none"><b>An illustrated edition of <i>The 1619 Project</i>, with newly commissioned artwork and archival images, <i>The New York Times Magazine</i>'s award-winning reframing of the American founding and its contemporary echoes, placing slavery and resistance at the center of the American story.</b><br /><br /><i>Here, in these pages, Black art provides refuge. The marriage of beautiful, haunting and profound words and imagery creates an experience for the reader, a wanting to reflect, to sit in both the discomfort and the joy, to contemplate what a nation owes a people who have contributed so much and yet received so little, and maybe even, to act. --Nikole Hannah-Jones, from the Preface</i><br /><br />Curated by the editors of <i>The New York Times Magazine</i>, led by Pulitzer Prize-winning journalist Nikole Hannah-Jones, this illustrated edition of <i>The 1619 Project </i>features seven chapters from the original book that lend themselves to beautiful, engaging visuals, deepening the experience of the content. <i>The 1619 A Visual Experience </i>offers the same revolutionary idea as the original book, an argument for a new national origin story that begins in late August of 1619, when a cargo ship of enslaved people from Africa arrived on the shores of Jamestown, Virginia. Only by reckoning with this difficult history and understanding its powerful influence on our present can we prepare ourselves for a more just future. <br /><br />Filled with original art by thirteen Black artists like Carrie Mae Weems, Calida Rawles, Vitus Shell, Xaviera Simmons, on the themes of resistance and freedom, a brand-new photo essay about slave auction sites, vivid photos of Black Americans celebrating their own forms of patriotism, and a collection of archival images of Black families by Black photographers, this gorgeous volume offers readers a dynamic new way of experiencing the impact of <i>The 1619 Project</i>.<br /><br />Complete with many of the powerful essays and vignettes from the original edition, written by some of the most brilliant journalists, scholars, and thinkers of our time, <i>The 1619 A Visual Experience </i>brings to life a fuller, more comprehensive understanding of American history and culture.</span> <a data-text-id="17435021734206715912" href="#" onclick="swapContent($(this));; return false;">...more</a> <br /> <a class="actionLink detailsLink" style="float: right" href="/giveaway/show/395167-the-1619-project-a-visual-experience">View Details »</a> </div> </div> </div> <div class=" actions giveawayPreviewDetailsContainer"> <div class="mediumTextBottomPadded"> <a class="gr-button" rel="nofollow" href="/giveaway/enter_choose_address/395167-the-1619-project-a-visual-experience">Enter Giveaway</a> </div> <div class="sansSerif"> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Format:</b> Print book </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Giveaway ends in:</b> <strong id="timer_395167" class="countdownText">a</strong> <script type="text/javascript" charset="utf-8"> //<![CDATA[ var timer_395167_end_at = 16272 + new Date().getTime()/1000; function timer_395167_updateTimer() { var time_left = ""; var secs_left = timer_395167_end_at - new Date().getTime()/1000; if(secs_left <= 0) { document.getElementById("timer_395167").innerHTML = "closed"; clearInterval(timer_395167_updater); return; } var minutes_left = secs_left / 60; var hours_left = minutes_left / 60; var days_left = Math.floor(hours_left / 24); if(days_left > 0) { if(false){ time_left += days_left + ":"; }else{ time_left += days_left + " days and "; } } if(false){ time_left += Math.floor(hours_left%24/10) time_left += Math.floor(hours_left%24)%10 + ":"; }else{ time_left += Math.floor(hours_left%24) + ":"; } time_left += Math.floor(minutes_left%60/10); time_left += Math.floor(minutes_left%10) + ":"; time_left += Math.floor(secs_left%60/10); time_left += Math.floor(secs_left%10); document.getElementById("timer_395167").innerHTML = time_left; } timer_395167_updateTimer(); var timer_395167_updater = setInterval(timer_395167_updateTimer, 100); //]]> </script> <br/> </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Availability:</b> 15 copies available, 10873 people requesting </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Giveaway dates:</b> Nov 21 - Dec 12, 2024 </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Countries available:</b> U.S. </p> <div> </div> </div> </div> <div class="clear"></div> </li> <li class="listElement giveawayListItem"> <div class="giveawayPreviewBookContainer"> <div class="coverImage"> <a href="/book/show/220990228-future-polity"><img alt="Future Polity by Mohamed Al Jneibi" title="Future Polity by Mohamed Al Jneibi" width="90" class="bookCover" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1730231543l/220990228._SX98_.jpg" /></a> </div> <div class="description descriptionContainer"> <a class="bookTitle" href="https://www.goodreads.com/book/show/220990228-future-polity">Future Polity: Using Autonomous Policymaking to Shape Progressive Societies</a> <br/> <div id="bookAuthors" class=""> <span class='by'>by</span> <span itemprop='author' itemscope='' itemtype='http://schema.org/Person'> <div class='authorName__container'> <a class="authorName" itemprop="url" href="https://www.goodreads.com/author/show/52904165.Mohamed_Al_Jneibi"><span itemprop="name">Mohamed Al Jneibi</span></a> <span class="greyText">(Goodreads Author)</span> </div> </span> </div> <br/> <div class="greyText releaseDate">Release date: Dec 12, 2024</div> <div class="giveawayDescriptionDetails"> <span id="freeTextContainer11401573349482523112">We&apos;re giving away 100 free ebooks of Future Polity! Discover how AI can revolutionize global governance and resolve conflicts for a peaceful future. </span> <span id="freeText11401573349482523112" style="display:none">We're giving away 100 free ebooks of Future Polity! Discover how AI can revolutionize global governance and resolve conflicts for a peaceful future. </span> <a data-text-id="11401573349482523112" href="#" onclick="swapContent($(this));; return false;">...more</a> <br /> <a class="actionLink detailsLink" style="float: right" href="/giveaway/show/400983-future-polity-using-autonomous-policymaking-to-shape-progressive-societ">View Details »</a> </div> </div> </div> <div class=" actions giveawayPreviewDetailsContainer"> <div class="mediumTextBottomPadded"> <a class="gr-button" rel="nofollow" href="/giveaway/enter_kindle_giveaway/400983-future-polity-using-autonomous-policymaking-to-shape-progressive-societ">Enter Giveaway</a> </div> <div class="sansSerif"> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Format:</b> <img alt="Kindle book" src="https://s.gr-assets.com/assets/kindle_logo-a2f70ffa7db0218336b74c0d104db407.png" /> </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Giveaway ends in:</b> <strong id="timer_400983" class="countdownText">a</strong> <script type="text/javascript" charset="utf-8"> //<![CDATA[ var timer_400983_end_at = 102672 + new Date().getTime()/1000; function timer_400983_updateTimer() { var time_left = ""; var secs_left = timer_400983_end_at - new Date().getTime()/1000; if(secs_left <= 0) { document.getElementById("timer_400983").innerHTML = "closed"; clearInterval(timer_400983_updater); return; } var minutes_left = secs_left / 60; var hours_left = minutes_left / 60; var days_left = Math.floor(hours_left / 24); if(days_left > 0) { if(false){ time_left += days_left + ":"; }else{ time_left += days_left + " days and "; } } if(false){ time_left += Math.floor(hours_left%24/10) time_left += Math.floor(hours_left%24)%10 + ":"; }else{ time_left += Math.floor(hours_left%24) + ":"; } time_left += Math.floor(minutes_left%60/10); time_left += Math.floor(minutes_left%10) + ":"; time_left += Math.floor(secs_left%60/10); time_left += Math.floor(secs_left%10); document.getElementById("timer_400983").innerHTML = time_left; } timer_400983_updateTimer(); var timer_400983_updater = setInterval(timer_400983_updateTimer, 100); //]]> </script> <br/> </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Availability:</b> 100 copies available, 528 people requesting </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Giveaway dates:</b> Nov 16 - Dec 13, 2024 </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Countries available:</b> U.S. </p> <div> </div> </div> </div> <div class="clear"></div> </li> <li class="listElement giveawayListItem"> <div class="giveawayPreviewBookContainer"> <div class="coverImage"> <a href="/book/show/212378273-last-twilight-in-paris"><img alt="Last Twilight in Paris by Pam Jenoff" title="Last Twilight in Paris by Pam Jenoff" width="90" class="bookCover" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1727361151l/212378273._SX98_.jpg" /></a> </div> <div class="description descriptionContainer"> <a class="bookTitle" href="https://www.goodreads.com/book/show/212378273-last-twilight-in-paris">Last Twilight in Paris</a> <br/> <div id="bookAuthors" class=""> <span class='by'>by</span> <span itemprop='author' itemscope='' itemtype='http://schema.org/Person'> <div class='authorName__container'> <a class="authorName" itemprop="url" href="https://www.goodreads.com/author/show/213562.Pam_Jenoff"><span itemprop="name">Pam Jenoff</span></a> <span class="greyText">(Goodreads Author)</span> </div> </span> </div> <br/> <div class="greyText releaseDate">Release date: Feb 04, 2025</div> <div class="giveawayDescriptionDetails"> <span id="freeTextContainer16693686492439062121">Enter for a chance to win 1 of 10 Advanced Reading Copies of Last Twilight in Paris by Pam Jenoff!</span> <br /> <a class="actionLink detailsLink" style="float: right" href="/giveaway/show/400819-last-twilight-in-paris">View Details »</a> </div> </div> </div> <div class=" actions giveawayPreviewDetailsContainer"> <div class="mediumTextBottomPadded"> <a class="gr-button" rel="nofollow" href="/giveaway/enter_choose_address/400819-last-twilight-in-paris">Enter Giveaway</a> </div> <div class="sansSerif"> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Format:</b> Print book </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Giveaway ends in:</b> <strong id="timer_400819" class="countdownText">a</strong> <script type="text/javascript" charset="utf-8"> //<![CDATA[ var timer_400819_end_at = 189072 + new Date().getTime()/1000; function timer_400819_updateTimer() { var time_left = ""; var secs_left = timer_400819_end_at - new Date().getTime()/1000; if(secs_left <= 0) { document.getElementById("timer_400819").innerHTML = "closed"; clearInterval(timer_400819_updater); return; } var minutes_left = secs_left / 60; var hours_left = minutes_left / 60; var days_left = Math.floor(hours_left / 24); if(days_left > 0) { if(false){ time_left += days_left + ":"; }else{ time_left += days_left + " days and "; } } if(false){ time_left += Math.floor(hours_left%24/10) time_left += Math.floor(hours_left%24)%10 + ":"; }else{ time_left += Math.floor(hours_left%24) + ":"; } time_left += Math.floor(minutes_left%60/10); time_left += Math.floor(minutes_left%10) + ":"; time_left += Math.floor(secs_left%60/10); time_left += Math.floor(secs_left%10); document.getElementById("timer_400819").innerHTML = time_left; } timer_400819_updateTimer(); var timer_400819_updater = setInterval(timer_400819_updateTimer, 100); //]]> </script> <br/> </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Availability:</b> 10 copies available, 21933 people requesting </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Giveaway dates:</b> Nov 14 - Dec 14, 2024 </p> <p class="giveawayDetailItem"> <b class="giveawayDetailItemTitle">Countries available:</b> U.S. </p> <div> </div> </div> </div> <div class="clear"></div> </li> <div class="moreLink"> <a class="actionLink" href="/giveaway/genre/history">More book giveaways...</a> </div> </div> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div class="coverBigBox clearFloats bigBox" show_header="true"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/genres/most_read/history">Most Read This Week</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_216857785"> <a href="/book/show/216857785-revenge-of-the-tipping-point"><img alt="Revenge of the Tipping Point: Overstories, Superspreaders, and the Rise of Social Engineering" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1721984170l/216857785.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_216857785'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/216857785-revenge-of-the-tipping-point?from_choice=false&amp;from_home_module=false\">Revenge of the Tipping Point: Overstories, Superspreaders, and the Rise of Social Engineering<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1439.Malcolm_Gladwell\">Malcolm Gladwell<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.10 avg rating &mdash; 12,881 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer3274991119532236780\">Twenty-five years after the publication of his groundbreaking first book, Malcolm Gladwell returns with a brand-new volume that reframes the lessons of The Tipping Point in a startling and revealing light.\n\nWhy is Miami…Miami? What does the heartbreaking fate of the cheetah tell us about the way we <\/span>\n <span id=\"freeText3274991119532236780\" style=\"display:none\">Twenty-five years after the publication of his groundbreaking first book, Malcolm Gladwell returns with a brand-new volume that reframes the lessons of The Tipping Point in a startling and revealing light.\n\nWhy is Miami…Miami? What does the heartbreaking fate of the cheetah tell us about the way we raise our children? Why do Ivy League schools care so much about sports? What is the Magic Third, and what does it mean for racial harmony? In this provocative new work, Malcolm Gladwell returns for the first time in twenty-five years to the subject of social epidemics and tipping points, this time with the aim of explaining the dark side of contagious phenomena.\n \nThrough a series of riveting stories, Gladwell traces the rise of a new and troubling form of social engineering. He takes us to the streets of Los Angeles to meet the world’s most successful bank robbers, rediscovers a forgotten television show from the 1970s that changed the world, visits the site of a historic experiment on a tiny cul-de-sac in northern California, and offers an alternate history of two of the biggest epidemics of our day: COVID and the opioid crisis. Revenge of the Tipping Point is Gladwell’s most personal book yet. With his characteristic mix of storytelling and social science, he offers a guide to making sense of the contagions of modern world. It’s time we took tipping points seriously.<\/span>\n <a data-text-id=\"3274991119532236780\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_216857785').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_216857785').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_216857785').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_216857785').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_52022378"> <a href="/book/show/52022378-sheever-s-journal-diary-of-a-poison-master"><img alt="Sheever&#39;s Journal, Diary of a Poison Master" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1583221123l/52022378._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_52022378'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/52022378-sheever-s-journal-diary-of-a-poison-master?from_choice=false&amp;from_home_module=false\">Sheever&#39;s Journal, Diary of a Poison Master<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/2633143.K_Ritz\">K. Ritz<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.31 avg rating &mdash; 16,229 ratings<\/span> &mdash; published 2019\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer11146956886957756765\">Synopsis: For five years Me’acca Mysuth Sheever has lived among his “sworn enemies,” pretending to be one of them. One night he buys a journal, its pages blank. The woman who sells him the journal extracts his promise to record his deeds for study. “Lo, the steps of your life mark the journey of you<\/span>\n <span id=\"freeText11146956886957756765\" style=\"display:none\">Synopsis: For five years Me’acca Mysuth Sheever has lived among his “sworn enemies,” pretending to be one of them. One night he buys a journal, its pages blank. The woman who sells him the journal extracts his promise to record his deeds for study. “Lo, the steps of your life mark the journey of your soul.” To expose his prior life, however, would be akin to suicide, for Sheever is a man brimming with secrets. He begins the journal cautiously, describing the area where he works as a cook, and the people he’s forced to endure. Hints of his past emerge as he also records day-to-day events. As the journal evolves, he finds himself more entangled than he ever wanted to be in the lives around him, and more sympathetic to people he wanted to hate. Memories haunt him, and he struggles to maintain a grip on his sanity as he prays for – and fears – the signal that his years in exile have ended and he can return home. This then is Sheever’s Journal, Diary of a Poison Master. About the Author: K. Ritz lives with her husband in a small town in Massachusetts. This is her first book in a series about a world of shadows. <\/span>\n <a data-text-id=\"11146956886957756765\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_52022378').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_52022378').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_52022378').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_52022378').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_61714633"> <a href="/book/show/61714633-the-wager"><img alt="The Wager: A Tale of Shipwreck, Mutiny and Murder" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1659407155l/61714633.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_61714633'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/61714633-the-wager?from_choice=false&amp;from_home_module=false\">The Wager: A Tale of Shipwreck, Mutiny and Murder<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1431785.David_Grann\">David Grann<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.18 avg rating &mdash; 145,285 ratings<\/span> &mdash; published 2023\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer15163080522836916999\">From the #1 New York Times bestselling author of Killers of the Flower Moon, a page-turning story of shipwreck, survival, and savagery, culminating in a court martial that reveals a shocking truth. The powerful narrative reveals the deeper meaning of the events on the Wager, showing that it was not <\/span>\n <span id=\"freeText15163080522836916999\" style=\"display:none\">From the #1 New York Times bestselling author of Killers of the Flower Moon, a page-turning story of shipwreck, survival, and savagery, culminating in a court martial that reveals a shocking truth. The powerful narrative reveals the deeper meaning of the events on the Wager, showing that it was not only the captain and crew who ended up on trial, but the very idea of empire.\n\nOn January 28, 1742, a ramshackle vessel of patched-together wood and cloth washed up on the coast of Brazil. Inside were thirty emaciated men, barely alive, and they had an extraordinary tale to tell. They were survivors of His Majesty\'s Ship the Wager, a British vessel that had left England in 1740 on a secret mission during an imperial war with Spain. While the Wager had been chasing a Spanish treasure-filled galleon known as &quot;the prize of all the oceans,&quot; it had wrecked on a desolate island off the coast of Patagonia. The men, after being marooned for months and facing starvation, built the flimsy craft and sailed for more than a hundred days, traversing nearly 3,000 miles of storm-wracked seas. They were greeted as heroes.\n\nBut then . . . six months later, another, even more decrepit craft landed on the coast of Chile. This boat contained just three castaways, and they told a very different story. The thirty sailors who landed in Brazil were not heroes - they were mutineers. The first group responded with countercharges of their own, of a tyrannical and murderous senior officer and his henchmen. It became clear that while stranded on the island the crew had fallen into anarchy, with warring factions fighting for dominion over the barren wilderness. As accusations of treachery and murder flew, the Admiralty convened a court martial to determine who was telling the truth. The stakes were life-and-death--for whomever the court found guilty could hang.\n\nThe Wager is a grand tale of human behavior at the extremes told by one of our greatest nonfiction writers. Grann\'s recreation of the hidden world on a British warship rivals the work of Patrick O\'Brian, his portrayal of the castaways\' desperate straits stands up to the classics of survival writing such as The Endurance, and his account of the court martial has the savvy of a Scott Turow thriller. As always with Grann\'s work, the incredible twists of the narrative hold the reader spellbound.<\/span>\n <a data-text-id=\"15163080522836916999\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_61714633').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_61714633').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_61714633').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_61714633').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_203956674"> <a href="/book/show/203956674-the-small-and-the-mighty"><img alt="The Small and the Mighty: Twelve Unsung Americans Who Changed the Course of History, from the Founding to the Civil Rights Movement" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1711238684l/203956674._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_203956674'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/203956674-the-small-and-the-mighty?from_choice=false&amp;from_home_module=false\">The Small and the Mighty: Twelve Unsung Americans Who Changed the Course of History, from the Founding to the Civil Rights Movement<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/4785161.Sharon_McMahon\">Sharon McMahon<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><\/span> 4.58 avg rating &mdash; 10,837 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer902284263132805273\">America’s favorite government teacher offers thrilling, heartfelt stories of ordinary American heroes.Most pundits and historians sell a dangerously naïve version of the American story—either praising its most consequential figures uncritically or criticizing them unfairly. Sharon McMahon believes t<\/span>\n <span id=\"freeText902284263132805273\" style=\"display:none\">America’s favorite government teacher offers thrilling, heartfelt stories of ordinary American heroes.Most pundits and historians sell a dangerously naïve version of the American story—either praising its most consequential figures uncritically or criticizing them unfairly. Sharon McMahon believes the truth is more human. In her debut book The Small and the Mighty, she tells the inpiring stories of twelve Americans--regular people with human foibles--whose extraordinary heroism in the face of mounting trials created the character of our country. With the same clarity and candor that\'s earned her millions of fans, McMahon follows the daughter of formerly enslaved parents who sparked a reformation in Black education, a Japanese immigrant who nearly died in combat and became a consequential Senator, and even the electrician who saved her husband’s life. Her unforgettable prose and meticulous research tell the story of America from the perspective of the unsung heroes whose devotion to their country will restore your faith in the American dream.The portraits of our nation’s most improbable champions, innovators, and rebels in this book celebrate the United States and reveal our common humanity. The Small and the Mighty is the encouragement we all need in an age of doomscrolling and division.<\/span>\n <a data-text-id=\"902284263132805273\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_203956674').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_203956674').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_203956674').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_203956674').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_210943364"> <a href="/book/show/210943364-the-message"><img alt="The Message" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1717094243l/210943364.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_210943364'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/210943364-the-message?from_choice=false&amp;from_home_module=false\">The Message<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1214964.Ta_Nehisi_Coates\">Ta-Nehisi Coates<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><\/span> 4.56 avg rating &mdash; 12,298 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer3295877412957206050\">Ta-Nehisi Coates originally set off to write a book about writing, in the tradition of Orwell’s classic Politics and the English Language, but found himself grappling with deeper questions about how our stories—our reporting and imaginative narratives and mythmaking—expose and distort our realities.<\/span>\n <span id=\"freeText3295877412957206050\" style=\"display:none\">Ta-Nehisi Coates originally set off to write a book about writing, in the tradition of Orwell’s classic Politics and the English Language, but found himself grappling with deeper questions about how our stories—our reporting and imaginative narratives and mythmaking—expose and distort our realities. \n\nThe first of the book’s three intertwining essays is set in Dakar, Senegal. Despite being raised as a strict Afrocentrist, Coates had never set foot on the African continent until now. He roams the “steampunk” city of “old traditions and new machinery,” but everywhere he goes he feels as if he’s in two places at once: a modern city in Senegal and a mythic kingdom in his mind. Finally he travels to the slave castles off the coast and has his own reckoning with the legacy of the Afrocentric dream.\n\nHe takes readers along with him to Columbia, South Carolina, where he meets an educator whose job is threatened for teaching one of Coates’s own books. There he discovers a community of mostly white supporters who were transformed by the “racial reckoning” of 2020. But he also explores the backlash to this reckoning and the deeper myths of the community—a capital of the confederacy with statues of segregationists looming over its public squares.\n\nAnd in Palestine, Coates discovers the devastating gap between the narratives we’ve accepted and the clashing reality of life on the ground. He meets with activists and dissidents, Israelis and Palestinians—the old, who remember their dispossessions on two continents, and the young, who have only known struggle and disillusionment. He travels into Jerusalem, the heart of Zionist mythology, and to the occupied territories, where he sees the reality the myth is meant to hide. It is this hidden story that draws him in and profoundly changes him—and makes the war that would soon come all the more devastating.\n\nWritten at a dramatic moment in American and global life, this work from one of the country’s most important writers is about the urgent need to untangle ourselves from the destructive nationalist myths that shape our world—and our own souls—and embrace the liberating power of even the most difficult truths.<\/span>\n <a data-text-id=\"3295877412957206050\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_210943364').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_210943364').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_210943364').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_210943364').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_62873378"> <a href="/book/show/62873378-the-art-thief"><img alt="The Art Thief: A True Story of Love, Crime, and a Dangerous Obsession" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1701688707l/62873378._SX318_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_62873378'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/62873378-the-art-thief?from_choice=false&amp;from_home_module=false\">The Art Thief: A True Story of Love, Crime, and a Dangerous Obsession<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/206768.Michael_Finkel\">Michael Finkel<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 3.96 avg rating &mdash; 51,143 ratings<\/span> &mdash; published 2023\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer16851990189202183541\">One of the most remarkable true-crime narratives of the twenty-first century: the story of the world’s most prolific art thief, Stéphane Breitwieser.\n\nIn this spellbinding portrait of obsession and flawed genius, the best-selling author of The Stranger in the Woods brings us into Breitwieser’s stran<\/span>\n <span id=\"freeText16851990189202183541\" style=\"display:none\">One of the most remarkable true-crime narratives of the twenty-first century: the story of the world’s most prolific art thief, Stéphane Breitwieser.\n\nIn this spellbinding portrait of obsession and flawed genius, the best-selling author of The Stranger in the Woods brings us into Breitwieser’s strange world—unlike most thieves, he never stole for money, keeping all his treasures in a single room where he could admire them.\n\nFor centuries, works of art have been stolen in countless ways from all over the world, but no one has been quite as successful at it as the master thief Stéphane Breitwieser. Carrying out more than two hundred heists over nearly eight years—in museums and cathedrals all over Europe—Breitwieser, along with his girlfriend who worked as his lookout, stole more than three hundred objects, until it all fell apart in spectacular fashion.\n\nIn The Art Thief, Michael Finkel brings us into Breitwieser’s strange and fascinating world. Unlike most thieves, Breitwieser never stole for money. Instead, he displayed all his treasures in a pair of secret rooms where he could admire them to his heart’s content. Possessed of a remarkable athleticism and an innate ability to circumvent practically any security system, Breitwieser managed to pull off a breathtaking number of audacious thefts. Yet these strange talents bred a growing disregard for risk and an addict’s need to score, leading Breitwieser to ignore his girlfriend’s pleas to stop—until one final act of hubris brought everything crashing down.\n\nThis is a riveting story of art, crime, love, and an insatiable hunger to possess beauty at any cost.<\/span>\n <a data-text-id=\"16851990189202183541\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_62873378').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_62873378').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_62873378').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_62873378').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_209786389"> <a href="/book/show/209786389-framed"><img alt="Framed: Astonishing True Stories of Wrongful Convictions" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1711027483l/209786389.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_209786389'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/209786389-framed?from_choice=false&amp;from_home_module=false\">Framed: Astonishing True Stories of Wrongful Convictions<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/721.John_Grisham\">John Grisham<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.19 avg rating &mdash; 5,488 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer10787147681785642028\">In his first work of nonfiction since The Innocent Man, #1 bestselling author John Grisham and Centurion Ministries Founder Jim McCloskey share ten harrowing true stories of wrongful convictions. Impeccably researched and grippingly told, Framed offers an inside look at the injustice faced by the vi<\/span>\n <span id=\"freeText10787147681785642028\" style=\"display:none\">In his first work of nonfiction since The Innocent Man, #1 bestselling author John Grisham and Centurion Ministries Founder Jim McCloskey share ten harrowing true stories of wrongful convictions. Impeccably researched and grippingly told, Framed offers an inside look at the injustice faced by the victims of the United States criminal justice system.\n\nA fundamental principle of our legal system is a presumption of innocence, but once someone has been found guilty there is very little room to prove doubt. Framed shares ten true stories of men who were innocent but found guilty and forced to sacrifice friends, families, wives, and decades of their lives to prison while the guilty parties remained free. In each of the stories, John Grisham and Jim McCloskey recount the dramatic hard-fought battles for exoneration. They take a close look at what leads to wrongful convictions in the first place, and the racism, misconduct, flawed testimony, and the corrupt court system that can make them so hard to reverse.\n\nTold with page-turning suspense as only John Grisham can deliver, Framed is the story of overcoming adversity when the battle already seems lost, and the deck is stacked against you.<\/span>\n <a data-text-id=\"10787147681785642028\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_209786389').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_209786389').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_209786389').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_209786389').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_58490567"> <a href="/book/show/58490567-the-diamond-eye"><img alt="The Diamond Eye" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1641777418l/58490567.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_58490567'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/58490567-the-diamond-eye?from_choice=false&amp;from_home_module=false\">The Diamond Eye<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/2974095.Kate_Quinn\">Kate Quinn<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.29 avg rating &mdash; 159,568 ratings<\/span> &mdash; published 2022\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer18309295204904564141\">The New York Times bestselling author of The Rose Code returns with an unforgettable World War II tale of a quiet bookworm who becomes history&apos;s deadliest female sniper. Based on a true story.In 1937 in the snowbound city of Kyiv, wry and bookish history student Mila Pavlichenko organizes her life a<\/span>\n <span id=\"freeText18309295204904564141\" style=\"display:none\">The New York Times bestselling author of The Rose Code returns with an unforgettable World War II tale of a quiet bookworm who becomes history\'s deadliest female sniper. Based on a true story.In 1937 in the snowbound city of Kyiv, wry and bookish history student Mila Pavlichenko organizes her life around her library job and her young son--but Hitler\'s invasion of Ukraine and Russia sends her on a different path. Given a rifle and sent to join the fight, Mila must forge herself from studious girl to deadly sniper--a lethal hunter of Nazis known as Lady Death. When news of her three hundredth kill makes her a national heroine, Mila finds herself torn from the bloody battlefields of the eastern front and sent to America on a goodwill tour.\n\nStill reeling from war wounds and devastated by loss, Mila finds herself isolated and lonely in the glittering world of Washington, DC--until an unexpected friendship with First Lady Eleanor Roosevelt and an even more unexpected connection with a silent fellow sniper offer the possibility of happiness. But when an old enemy from Mila\'s past joins forces with a deadly new foe lurking in the shadows, Lady Death finds herself battling her own demons and enemy bullets in the deadliest duel of her life.\n\nBased on a true story, The Diamond Eye is a haunting novel of heroism born of desperation, of a mother who became a soldier, of a woman who found her place in the world and changed the course of history forever.<\/span>\n <a data-text-id=\"18309295204904564141\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_58490567').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_58490567').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_58490567').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_58490567').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_122765395"> <a href="/book/show/122765395-elon-musk"><img alt="Elon Musk" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1692288251l/122765395._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_122765395'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/122765395-elon-musk?from_choice=false&amp;from_home_module=false\">Elon Musk<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/7111.Walter_Isaacson\">Walter Isaacson<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.39 avg rating &mdash; 53,936 ratings<\/span> &mdash; published 2023\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer11731310972201335614\">From the author of Steve Jobs and other bestselling biographies, this is the astonishingly intimate story of the most fascinating and controversial innovator of our era—a rule-breaking visionary who helped to lead the world into the era of electric vehicles, private space exploration, and artificial<\/span>\n <span id=\"freeText11731310972201335614\" style=\"display:none\">From the author of Steve Jobs and other bestselling biographies, this is the astonishingly intimate story of the most fascinating and controversial innovator of our era—a rule-breaking visionary who helped to lead the world into the era of electric vehicles, private space exploration, and artificial intelligence. Oh, and took over Twitter.\n\nWhen Elon Musk was a kid in South Africa, he was regularly beaten by bullies. One day a group pushed him down some concrete steps and kicked him until his face was a swollen ball of flesh. He was in the hospital for a week. But the physical scars were minor compared to the emotional ones inflicted by his father, an engineer, rogue, and charismatic fantasist.\n\nHis father’s impact on his psyche would linger. He developed into a tough yet vulnerable man-child, prone to abrupt Jekyll-and-Hyde mood swings, with an exceedingly high tolerance for risk, a craving for drama, an epic sense of mission, and a maniacal intensity that was callous and at times destructive.\n\nAt the beginning of 2022—after a year marked by SpaceX launching thirty-one rockets into orbit, Tesla selling a million cars, and him becoming the richest man on earth—Musk spoke ruefully about his compulsion to stir up dramas. “I need to shift my mindset away from being in crisis mode, which it has been for about fourteen years now, or arguably most of my life,” he said.\n\nIt was a wistful comment, not a New Year’s resolution. Even as he said it, he was secretly buying up shares of Twitter, the world’s ultimate playground. Over the years, whenever he was in a dark place, his mind went back to being bullied on the playground. Now he had the chance to own the playground.\n\nFor two years, Isaacson shadowed Musk, attended his meetings, walked his factories with him, and spent hours interviewing him, his family, friends, coworkers, and adversaries. The result is the revealing inside story, filled with amazing tales of triumphs and turmoil, that addresses the are the demons that drive Musk also what it takes to drive innovation and progress?<\/span>\n <a data-text-id=\"11731310972201335614\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_122765395').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_122765395').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_122765395').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_122765395').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_53239311"> <a href="/book/show/53239311-the-happiest-man-on-earth"><img alt="The Happiest Man on Earth" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1595373758l/53239311._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_53239311'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/53239311-the-happiest-man-on-earth?from_choice=false&amp;from_home_module=false\">The Happiest Man on Earth<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/20228583.Eddie_Jaku\">Eddie Jaku<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p6\"><\/span><\/span> 4.62 avg rating &mdash; 95,422 ratings<\/span> &mdash; published 2020\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer5381131117357301687\">Life can be beautiful if you make it beautiful. It is up to you.\n\nEddie Jaku always considered himself a German first, a Jew second. He was proud of his country. But all of that changed in November 1938, when he was beaten, arrested and taken to a concentration camp.\n\nOver the next seven years, Eddi<\/span>\n <span id=\"freeText5381131117357301687\" style=\"display:none\">Life can be beautiful if you make it beautiful. It is up to you.\n\nEddie Jaku always considered himself a German first, a Jew second. He was proud of his country. But all of that changed in November 1938, when he was beaten, arrested and taken to a concentration camp.\n\nOver the next seven years, Eddie faced unimaginable horrors every day, first in Buchenwald, then in Auschwitz, then on a Nazi death march. He lost family, friends, his country.\n\nBecause he survived, Eddie made the vow to smile every day. He pays tribute to those who were lost by telling his story, sharing his wisdom and living his best possible life. He now believes he is the \'happiest man on earth\'.\n\nPublished as Eddie turns 100, this is a powerful, heartbreaking and ultimately hopeful memoir of how happiness can be found even in the darkest of times.<\/span>\n <a data-text-id=\"5381131117357301687\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_53239311').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_53239311').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_53239311').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_53239311').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_182733784"> <a href="/book/show/182733784-nuclear-war"><img alt="Nuclear War: A Scenario" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1698060837l/182733784._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_182733784'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/182733784-nuclear-war?from_choice=false&amp;from_home_module=false\">Nuclear War: A Scenario<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/7032087.Annie_Jacobsen\">Annie Jacobsen<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.44 avg rating &mdash; 21,013 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer12102937602793356122\">There is only one scenario other than an asteroid strike that could end the world as we know it in a matter of hours: nuclear war. And one of the triggers for that war would be a nuclear missile inbound toward the United States.\n \nEvery generation, a journalist has looked deep into the heart of the <\/span>\n <span id=\"freeText12102937602793356122\" style=\"display:none\">There is only one scenario other than an asteroid strike that could end the world as we know it in a matter of hours: nuclear war. And one of the triggers for that war would be a nuclear missile inbound toward the United States.\n \nEvery generation, a journalist has looked deep into the heart of the nuclear military establishment: the technologies, the safeguards, the plans, and the risks. These investigations are vital to how we understand the world we really live in—where one nuclear missile will beget one in return, and where the choreography of the world’s end requires massive decisions made on seconds’ notice with information that is only as good as the intelligence we have.\n \nPulitzer Prize finalist Annie Jacobsen’s Nuclear War: A Scenario explores this ticking-clock scenario, based on dozens of exclusive new interviews with military and civilian experts who have built the weapons, have been privy to the response plans, and have been responsible for those decisions should they have needed to be made. Nuclear War: A Scenario examines the handful of minutes after a nuclear missile launch. It is essential reading, and unlike any other book in its depth and urgency.<\/span>\n <a data-text-id=\"12102937602793356122\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_182733784').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_182733784').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_182733784').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_182733784').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_195608683"> <a href="/book/show/195608683-the-demon-of-unrest"><img alt="The Demon of Unrest: A Saga of Hubris, Heartbreak, and Heroism at the Dawn of the Civil War" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1697649165l/195608683._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_195608683'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/195608683-the-demon-of-unrest?from_choice=false&amp;from_home_module=false\">The Demon of Unrest: A Saga of Hubris, Heartbreak, and Heroism at the Dawn of the Civil War<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/5869.Erik_Larson\">Erik Larson<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.21 avg rating &mdash; 32,572 ratings<\/span> &mdash; published 2024\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer2042688113816422189\">The #1 New York Times bestselling author of The Splendid and the Vile brings to life the pivotal five months between the election of Abraham Lincoln and the start of the Civil War—a slow-burning crisis that finally tore a deeply divided nation in two.\n\nOn November 6, 1860, Abraham Lincoln became the<\/span>\n <span id=\"freeText2042688113816422189\" style=\"display:none\">The #1 New York Times bestselling author of The Splendid and the Vile brings to life the pivotal five months between the election of Abraham Lincoln and the start of the Civil War—a slow-burning crisis that finally tore a deeply divided nation in two.\n\nOn November 6, 1860, Abraham Lincoln became the fluky victor in a tight race for president. The country was bitterly at odds; Southern extremists were moving ever closer to destroying the Union, with one state after another seceding and Lincoln powerless to stop them. Slavery fueled the conflict, but somehow the passions of North and South came to focus on a lonely federal fortress in Charleston: Fort Sumter.\n \nMaster storyteller Erik Larson offers a gripping account of the chaotic months between Lincoln’s election and the Confederacy’s shelling of Sumter—a period marked by tragic errors and miscommunications, enflamed egos and craven ambitions, personal tragedies and betrayals. Lincoln himself wrote that the trials of these five months were “so great that, could I have anticipated them, I would not have believed it possible to survive them.”\n \nAt the heart of this suspense-filled narrative are Major Robert Anderson, Sumter’s commander and a former slave owner sympathetic to the South but loyal to the Union; Edmund Ruffin, a vain and bloodthirsty radical who stirs secessionist ardor at every opportunity; and Mary Boykin Chesnut, wife of a prominent planter, conflicted over both marriage and slavery and seeing parallels between both. In the middle of it all is the overwhelmed Lincoln, battling with his duplicitous Secretary of State, William Seward, as he tries desperately to avert a war that he fears is inevitable—one that will eventually kill 750,000 Americans.\n \nDrawing on diaries, secret communiques, slave ledgers, and plantation records, Larson gives us a political horror story that captures the forces that led America to the brink—a dark reminder that we often don’t see a cataclysm coming until it’s too late.<\/span>\n <a data-text-id=\"2042688113816422189\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_195608683').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_195608683').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_195608683').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_195608683').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_55333938"> <a href="/book/show/55333938-the-personal-librarian"><img alt="The Personal Librarian" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1610646708l/55333938.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_55333938'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/55333938-the-personal-librarian?from_choice=false&amp;from_home_module=false\">The Personal Librarian<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/14815127.Marie_Benedict\">Marie Benedict<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.05 avg rating &mdash; 190,393 ratings<\/span> &mdash; published 2021\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer17846592140455780176\">This is a previously-published edition of ISBN 9780593101537.The remarkable, little-known story of Belle da Costa Greene, J. P. Morgan&apos;s personal librarian—who became one of the most powerful women in New York despite the dangerous secret she kept in order to make her dreams come true, from New York<\/span>\n <span id=\"freeText17846592140455780176\" style=\"display:none\">This is a previously-published edition of ISBN 9780593101537.The remarkable, little-known story of Belle da Costa Greene, J. P. Morgan\'s personal librarian—who became one of the most powerful women in New York despite the dangerous secret she kept in order to make her dreams come true, from New York Times bestselling author Marie Benedict and acclaimed author Victoria Christopher Murray. \n\nIn her twenties, Belle da Costa Greene is hired by J. P. Morgan to curate a collection of rare manuscripts, books, and artwork for his newly built Pierpont Morgan Library. Belle becomes a fixture on the New York society scene and one of the most powerful people in the art and book world, known for her impeccable taste and shrewd negotiating for critical works as she helps build a world-class collection.\n\nBut Belle has a secret, one she must protect at all costs. She was born not Belle da Costa Greene but Belle Marion Greener. She is the daughter of Richard Greener, the first Black graduate of Harvard and a well-known advocate for equality. Belle\'s complexion isn\'t dark because of her alleged Portuguese heritage that lets her pass as white—her complexion is dark because she is African American.The Personal Librarian tells the story of an extraordinary woman, famous for her intellect, style, and wit, and shares the lengths to which she must go—for the protection of her family and her legacy—to preserve her carefully crafted white identity in the racist world in which she lives.<\/span>\n <a data-text-id=\"17846592140455780176\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_55333938').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_55333938').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_55333938').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_55333938').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_60353768"> <a href="/book/show/60353768-the-marriage-portrait"><img alt="The Marriage Portrait" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1655741851l/60353768.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_60353768'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/60353768-the-marriage-portrait?from_choice=false&amp;from_home_module=false\">The Marriage Portrait<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/91236.Maggie_O_Farrell\">Maggie O\'Farrell<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.01 avg rating &mdash; 167,668 ratings<\/span> &mdash; published 2022\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer4767833665383708087\">An alternative cover edition for this ISBN can be found here.\n\nThe author of award-winning Hamnet brings the world of Renaissance Italy to jewel-bright life in this unforgettable fictional portrait of the captivating young duchess Lucrezia de’ Medici as she makes her way in a troubled court.\n\nFloren<\/span>\n <span id=\"freeText4767833665383708087\" style=\"display:none\">An alternative cover edition for this ISBN can be found here.\n\nThe author of award-winning Hamnet brings the world of Renaissance Italy to jewel-bright life in this unforgettable fictional portrait of the captivating young duchess Lucrezia de’ Medici as she makes her way in a troubled court.\n\nFlorence, the 1550s. Lucrezia, third daughter of the grand duke, is comfortable with her obscure place in the palazzo: free to wonder at its treasures, observe its clandestine workings, and devote herself to her own artistic pursuits. But when her older sister dies on the eve of her wedding to the ruler of Ferrara, Modena and Reggio, Lucrezia is thrust unwittingly into the limelight: the duke is quick to request her hand in marriage, and her father just as quick to accept on her behalf.\n \nHaving barely left girlhood behind, Lucrezia must now enter an unfamiliar court whose customs are opaque and where her arrival is not universally welcomed. Perhaps most mystifying of all is her new husband himself, Alfonso. Is he the playful sophisticate he appeared to be before their wedding, the aesthete happiest in the company of artists and musicians, or the ruthless politician before whom even his formidable sisters seem to tremble?\n \nAs Lucrezia sits in constricting finery for a painting intended to preserve her image for centuries to come, one thing becomes worryingly clear. In the court’s eyes, she has one duty: to provide the heir who will shore up the future of the Ferranese dynasty. Until then, for all of her rank and nobility, the new duchess’s future hangs entirely in the balance.\n \nFull of the beauty and emotion with which she illuminated the Shakespearean canvas of Hamnet, Maggie O’Farrell turns her talents to Renaissance Italy in an extraordinary portrait of a resilient young woman’s battle for her very survival.<\/span>\n <a data-text-id=\"4767833665383708087\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_60353768').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_60353768').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_60353768').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_60353768').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover340500_55145261"> <a href="/book/show/55145261-the-anthropocene-reviewed"><img alt="The Anthropocene Reviewed: Essays on a Human-Centered Planet" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1616514130l/55145261.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover340500_55145261'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/55145261-the-anthropocene-reviewed?from_choice=false&amp;from_home_module=false\">The Anthropocene Reviewed: Essays on a Human-Centered Planet<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1406384.John_Green\">John Green<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.36 avg rating &mdash; 142,007 ratings<\/span> &mdash; published 2021\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer14227318150509167081\">A deeply moving and mind-expanding collection of personal essays in the first ever work of non-fiction from #1 internationally bestselling author John Green\n\nThe Anthropocene is the current geological age, in which human activity has profoundly shaped the planet and its biodiversity. In this remarka<\/span>\n <span id=\"freeText14227318150509167081\" style=\"display:none\">A deeply moving and mind-expanding collection of personal essays in the first ever work of non-fiction from #1 internationally bestselling author John Green\n\nThe Anthropocene is the current geological age, in which human activity has profoundly shaped the planet and its biodiversity. In this remarkable symphony of essays adapted and expanded from his ground-breaking, critically acclaimed podcast, John Green reviews different facets of the human-centered planet - from the QWERTY keyboard and Halley\'s Comet to Penguins of Madagascar - on a five-star scale.\n\nComplex and rich with detail, the Anthropocene\'s reviews have been praised as \'observations that double as exercises in memoiristic empathy\', with over 10 million lifetime downloads. John Green\'s gift for storytelling shines throughout this artfully curated collection about the shared human experience; it includes beloved essays along with six all-new pieces exclusive to the book.<\/span>\n <a data-text-id=\"14227318150509167081\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover340500_55145261').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover340500_55145261').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover340500_55145261').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover340500_55145261').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="clear"></div> <div class="moreLink"> <a class="actionLink" href="/genres/most_read/history">More most read this week...</a> </div> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/list/show_tag/history">Lists</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="listRowsFull"> <div class="row" id="topRow"> <div class="cell"> <div class="listImgs"> <a href="/list/show/74334.Thought_Provoking"><img alt="The Beasts of Success by Jasun Ether" title="The Beasts of Success by Jasun Ether" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1585873555l/52861673._SX98_.jpg" /></a><a href="/list/show/74334.Thought_Provoking"><img alt="A New Earth by Eckhart Tolle" title="A New Earth by Eckhart Tolle" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1388206232l/76334._SX98_.jpg" /></a><a href="/list/show/74334.Thought_Provoking"><img alt="The Power of Now by Eckhart Tolle" title="The Power of Now by Eckhart Tolle" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1689947880l/6708._SX98_.jpg" /></a><a href="/list/show/74334.Thought_Provoking"><img alt="Walden by Henry David Thoreau" title="Walden by Henry David Thoreau" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1630470982l/16902._SX98_.jpg" /></a><a href="/list/show/74334.Thought_Provoking"><img alt="Stranger in a Strange Land by Robert A. Heinlein" title="Stranger in a Strange Land by Robert A. Heinlein" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1156897088l/350._SX98_.jpg" /></a> </div> <a class="listTitle" href="/list/show/74334.Thought_Provoking">Thought Provoking</a><br /> <div class="listFullDetails"> 2,648 books &mdash; 1,745 voters </div> </div> <div class="cell"> <div class="listImgs"> <a href="/list/show/800.India"><img alt="The God of Small Things by Arundhati Roy" title="The God of Small Things by Arundhati Roy" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1590282886l/9777._SX98_.jpg" /></a><a href="/list/show/800.India"><img alt="A Fine Balance by Rohinton Mistry" title="A Fine Balance by Rohinton Mistry" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1551173390l/5211._SX98_.jpg" /></a><a href="/list/show/800.India"><img alt="The White Tiger by Aravind Adiga" title="The White Tiger by Aravind Adiga" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1710937569l/1768603._SX98_.jpg" /></a><a href="/list/show/800.India"><img alt="Shantaram by Gregory David Roberts" title="Shantaram by Gregory David Roberts" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1333482282l/33600._SX98_.jpg" /></a><a href="/list/show/800.India"><img alt="Siddhartha by Hermann Hesse" title="Siddhartha by Hermann Hesse" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1629378189l/52036._SY160_.jpg" /></a> </div> <a class="listTitle" href="/list/show/800.India">India</a><br /> <div class="listFullDetails"> 996 books &mdash; 905 voters </div> </div> <br class="clear" /> </div> <div class="row"> <div class="cell"> <div class="listImgs"> <a href="/list/show/1362.Best_History_Books_"><img alt="John Adams by David McCullough" title="John Adams by David McCullough" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1478144278l/2203._SX98_.jpg" /></a><a href="/list/show/1362.Best_History_Books_"><img alt="The Rise and Fall of the Third Reich by William L. Shirer" title="The Rise and Fall of the Third Reich by William L. Shirer" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1331223772l/767171._SX98_.jpg" /></a><a href="/list/show/1362.Best_History_Books_"><img alt="1776 by David McCullough" title="1776 by David McCullough" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1306787560l/1067._SX98_.jpg" /></a><a href="/list/show/1362.Best_History_Books_"><img alt="Team of Rivals by Doris Kearns Goodwin" title="Team of Rivals by Doris Kearns Goodwin" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1676201263l/2199._SX98_.jpg" /></a><a href="/list/show/1362.Best_History_Books_"><img alt="The Guns of August by Barbara W. Tuchman" title="The Guns of August by Barbara W. Tuchman" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1617037342l/40779082._SX98_.jpg" /></a> </div> <a class="listTitle" href="/list/show/1362.Best_History_Books_">Best History Books </a><br /> <div class="listFullDetails"> 3,544 books &mdash; 3,617 voters </div> </div> <div class="cell"> <div class="listImgs"> <a href="/list/show/183.Tales_of_New_York_City_"><img alt="The Great Gatsby by F. Scott Fitzgerald" title="The Great Gatsby by F. Scott Fitzgerald" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1490528560l/4671._SX98_.jpg" /></a><a href="/list/show/183.Tales_of_New_York_City_"><img alt="The Catcher in the Rye by J.D. Salinger" title="The Catcher in the Rye by J.D. Salinger" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1398034300l/5107._SX98_.jpg" /></a><a href="/list/show/183.Tales_of_New_York_City_"><img alt="A Tree Grows in Brooklyn by Betty Smith" title="A Tree Grows in Brooklyn by Betty Smith" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1327883484l/14891._SX98_.jpg" /></a><a href="/list/show/183.Tales_of_New_York_City_"><img alt="Breakfast at Tiffany’s and Three Stories by Truman Capote" title="Breakfast at Tiffany’s and Three Stories by Truman Capote" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1477015353l/251688._SX98_.jpg" /></a><a href="/list/show/183.Tales_of_New_York_City_"><img alt="Extremely Loud &amp; Incredibly Close by Jonathan Safran Foer" title="Extremely Loud &amp; Incredibly Close by Jonathan Safran Foer" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1327879967l/4588._SX98_.jpg" /></a> </div> <a class="listTitle" href="/list/show/183.Tales_of_New_York_City_">Tales of New York City </a><br /> <div class="listFullDetails"> 1,485 books &mdash; 1,241 voters </div> </div> <br class="clear" /> </div> <div class="row"> <div class="cell"> <div class="listImgs"> <a href="/list/show/925.Women_and_Mental_Illness_fiction_and_nonfiction_"><img alt="The Bell Jar by Sylvia Plath" title="The Bell Jar by Sylvia Plath" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1554582218l/6514._SX98_.jpg" /></a><a href="/list/show/925.Women_and_Mental_Illness_fiction_and_nonfiction_"><img alt="Girl, Interrupted by Susanna Kaysen" title="Girl, Interrupted by Susanna Kaysen" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1475482930l/68783._SX98_.jpg" /></a><a href="/list/show/925.Women_and_Mental_Illness_fiction_and_nonfiction_"><img alt="The Yellow Wallpaper and Other Stories by Charlotte Perkins Gilman" title="The Yellow Wallpaper and Other Stories by Charlotte Perkins Gilman" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1327909237l/99300._SY160_.jpg" /></a><a href="/list/show/925.Women_and_Mental_Illness_fiction_and_nonfiction_"><img alt="The Virgin Suicides by Jeffrey Eugenides" title="The Virgin Suicides by Jeffrey Eugenides" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1319032910l/10956._SX98_.jpg" /></a><a href="/list/show/925.Women_and_Mental_Illness_fiction_and_nonfiction_"><img alt="Prozac Nation by Elizabeth Wurtzel" title="Prozac Nation by Elizabeth Wurtzel" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1282607176l/227603._SY160_.jpg" /></a> </div> <a class="listTitle" href="/list/show/925.Women_and_Mental_Illness_fiction_and_nonfiction_">Women and Mental Illness (fiction and nonfiction)</a><br /> <div class="listFullDetails"> 1,107 books &mdash; 2,248 voters </div> </div> <div class="cell"> <div class="listImgs"> <a href="/list/show/824.Best_Non_fiction_War_Books"><img alt="Band of Brothers by Stephen E. Ambrose" title="Band of Brothers by Stephen E. Ambrose" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1388247701l/42389._SX98_.jpg" /></a><a href="/list/show/824.Best_Non_fiction_War_Books"><img alt="Black Hawk Down by Mark Bowden" title="Black Hawk Down by Mark Bowden" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1553055240l/55403._SX98_.jpg" /></a><a href="/list/show/824.Best_Non_fiction_War_Books"><img alt="Unbroken by Laura Hillenbrand" title="Unbroken by Laura Hillenbrand" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1327861115l/8664353._SX98_.jpg" /></a><a href="/list/show/824.Best_Non_fiction_War_Books"><img alt="We Were Soldiers Once... and Young by Harold G. Moore" title="We Were Soldiers Once... and Young by Harold G. Moore" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1328912889l/42512._SX98_.jpg" /></a><a href="/list/show/824.Best_Non_fiction_War_Books"><img alt="Lone Survivor by Marcus Luttrell" title="Lone Survivor by Marcus Luttrell" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1344265535l/711901._SX98_.jpg" /></a> </div> <a class="listTitle" href="/list/show/824.Best_Non_fiction_War_Books">Best Non-fiction War Books</a><br /> <div class="listFullDetails"> 2,071 books &mdash; 2,367 voters </div> </div> </div> </div> <br class="clear" /> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div class="coverBigBox clearFloats bigBox" show_header="true"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/shelf/show/history">History Books</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_1842"> <a href="/book/show/1842.Guns_Germs_and_Steel"><img alt="Guns, Germs, and Steel: The Fates of Human Societies" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1453215833l/1842._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_1842'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/1842.Guns_Germs_and_Steel?from_choice=false&amp;from_home_module=false\">Guns, Germs, and Steel: The Fates of Human Societies<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/256.Jared_Diamond\">Jared Diamond<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.04 avg rating &mdash; 427,408 ratings<\/span> &mdash; published 1997\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer11991221250021994247\">&quot;Diamond has written a book of remarkable scope ... one of the most important and readable works on the human past published in recent years.&quot;\n\nWinner of the Pulitzer Prize and a national bestseller: the global account of the rise of civilization that is also a stunning refutation of ideas of human <\/span>\n <span id=\"freeText11991221250021994247\" style=\"display:none\">&quot;Diamond has written a book of remarkable scope ... one of the most important and readable works on the human past published in recent years.&quot;\n\nWinner of the Pulitzer Prize and a national bestseller: the global account of the rise of civilization that is also a stunning refutation of ideas of human development based on race.\n\nIn this &quot;artful, informative, and delightful&quot; (William H. McNeill, New York Review of Books) book, Jared Diamond convincingly argues that geographical and environmental factors shaped the modern world. Societies that had a head start in food production advanced beyond the hunter-gatherer stage, and then developed writing, technology, government, and organized religion—as well as nasty germs and potent weapons of war—and adventured on sea and land to conquer and decimate preliterate cultures. A major advance in our understanding of human societies, Guns, Germs, and Steel chronicles the way that the modern world came to be and stunningly dismantles racially based theories of human history.\n\nWinner of the Pulitzer Prize, the Phi Beta Kappa Award in Science, the Rhone-Poulenc Prize, and the Commonwealth Club of California\'s Gold Medal<\/span>\n <a data-text-id=\"11991221250021994247\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_1842').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_1842').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_1842').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_1842').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_2767"> <a href="/book/show/2767.A_People_s_History_of_the_United_States"><img alt="A People’s History of the United States: 1492 - Present" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1494279423l/2767._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_2767'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/2767.A_People_s_History_of_the_United_States?from_choice=false&amp;from_home_module=false\">A People’s History of the United States: 1492 - Present<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1899.Howard_Zinn\">Howard Zinn<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.08 avg rating &mdash; 251,255 ratings<\/span> &mdash; published 1980\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer13230333098320605624\">In the book, Zinn presented a different side of history from the more traditional &quot;fundamental nationalist glorification of country&quot;. \nZinn portrays a side of American history that can largely be seen as the exploitation and manipulation of the majority by rigged systems that hugely favor a small ag<\/span>\n <span id=\"freeText13230333098320605624\" style=\"display:none\">In the book, Zinn presented a different side of history from the more traditional &quot;fundamental nationalist glorification of country&quot;. \nZinn portrays a side of American history that can largely be seen as the exploitation and manipulation of the majority by rigged systems that hugely favor a small aggregate of elite rulers from across the orthodox political parties.\nA People\'s History has been assigned as reading in many high schools and colleges across the United States. It has also resulted in a change in the focus of historical work, which now includes stories that previously were ignored\n\nLibrary Journal calls Howard Zinn’s book “a brilliant and moving history of the American people from the point of view of those…whose plight has been largely omitted from most histories.”<\/span>\n <a data-text-id=\"13230333098320605624\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_2767').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_2767').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_2767').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_2767').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_397483"> <a href="/book/show/397483.The_Devil_in_the_White_City"><img alt="The Devil in the White City: Murder, Magic, and Madness at the Fair That Changed America" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1583433024l/397483.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_397483'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/397483.The_Devil_in_the_White_City?from_choice=false&amp;from_home_module=false\">The Devil in the White City: Murder, Magic, and Madness at the Fair That Changed America<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/5869.Erik_Larson\">Erik Larson<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\" title=\"really liked it\"><span size=\"12x12\" class=\"staticStar p10\">really liked it<\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p0\"><\/span><\/span> 4.00 avg rating &mdash; 710,674 ratings<\/span> &mdash; published 2003\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer5841543487691046882\">Author Erik Larson imbues the incredible events surrounding the 1893 Chicago World&apos;s Fair with such drama that readers may find themselves checking the book&apos;s categorization to be sure that &apos;The Devil in the White City&apos; is not, in fact, a highly imaginative novel. Larson tells the stories of two men<\/span>\n <span id=\"freeText5841543487691046882\" style=\"display:none\">Author Erik Larson imbues the incredible events surrounding the 1893 Chicago World\'s Fair with such drama that readers may find themselves checking the book\'s categorization to be sure that \'The Devil in the White City\' is not, in fact, a highly imaginative novel. Larson tells the stories of two men: Daniel H. Burnham, the architect responsible for the fair\'s construction, and H.H. Holmes, a serial killer masquerading as a charming doctor. \n\nBurnham\'s challenge was immense. In a short period of time, he was forced to overcome the death of his partner and numerous other obstacles to construct the famous &quot;White City&quot; around which the fair was built. His efforts to complete the project, and the fair\'s incredible success, are skillfully related along with entertaining appearances by such notables as Buffalo Bill Cody, Susan B. Anthony, and Thomas Edison. \n\nThe activities of the sinister Dr. Holmes, who is believed to be responsible for scores of murders around the time of the fair, are equally remarkable. He devised and erected the World\'s Fair Hotel, complete with crematorium and gas chamber, near the fairgrounds and used the event as well as his own charismatic personality to lure victims. \n\nCombining the stories of an architect and a killer in one book, mostly in alternating chapters, seems like an odd choice but it works. The magical appeal and horrifying dark side of 19th-century Chicago are both revealed through Larson\'s skillful writing. - John Moe<\/span>\n <a data-text-id=\"5841543487691046882\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_397483').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_397483').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_397483').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_397483').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_1067"> <a href="/book/show/1067.1776"><img alt="1776" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1306787560l/1067.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_1067'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/1067.1776?from_choice=false&amp;from_home_module=false\">1776<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/6281688.David_McCullough\">David McCullough<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.10 avg rating &mdash; 236,613 ratings<\/span> &mdash; published 2005\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer3517961033212052851\">In this masterful book, David McCullough tells the intensely human story of those who marched with General George Washington in the year of the Declaration of Independence - when the whole American cause was riding on their success, without which all hope for independence would have been dashed and <\/span>\n <span id=\"freeText3517961033212052851\" style=\"display:none\">In this masterful book, David McCullough tells the intensely human story of those who marched with General George Washington in the year of the Declaration of Independence - when the whole American cause was riding on their success, without which all hope for independence would have been dashed and the noble ideals of the Declaration would have amounted to little more than words on paper.\n\nBased on extensive research in both American and British archives, 1776 is a powerful drama written with extraordinary narrative vitality. It is the story of Americans in the ranks, men of every shape, size, and color, farmers, schoolteachers, shoemakers, no-accounts, and mere boys turned soldiers. And it is the story of the King\'s men, the British commander, William Howe, an his highly disciplined redcoats who looked on their rebel foes with contempt and fought with a valor too little known.\n\nAt the center of the drama, with Washington, are two young American patriots, who, at first, knew no more of war than what they had read in books - Nathaniel Green, a Quaker who was made a general at thirty-three, and Henry Knox, a twenty-five-year-old bookseller who had the preposterous idea of hauling the guns of Fort Ticonderoga overland to Boston in the dead of Winter.\n\nBut it is the American commander-in-chief who stands foremost - Washington, who had never before led an army in battle. Written as a companion work to his celebrated biography of John Adams, David McCullough\'s 1776 is another landmark in the literature of American history.<\/span>\n <a data-text-id=\"3517961033212052851\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_1067').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_1067').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_1067').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_1067').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_21"> <a href="/book/show/21.A_Short_History_of_Nearly_Everything"><img alt="A Short History of Nearly Everything" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1433086293l/21._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_21'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/21.A_Short_History_of_Nearly_Everything?from_choice=false&amp;from_home_module=false\">A Short History of Nearly Everything<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/7.Bill_Bryson\">Bill Bryson<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.22 avg rating &mdash; 399,517 ratings<\/span> &mdash; published 2003\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer7114938112987720990\">Bill Bryson describes himself as a reluctant traveller, but even when he stays safely at home he can&apos;t contain his curiosity about the world around him. &quot;A Short History of Nearly Everything&quot; is his quest to understand everything that has happened from the Big Bang to the rise of civilisation - how <\/span>\n <span id=\"freeText7114938112987720990\" style=\"display:none\">Bill Bryson describes himself as a reluctant traveller, but even when he stays safely at home he can\'t contain his curiosity about the world around him. &quot;A Short History of Nearly Everything&quot; is his quest to understand everything that has happened from the Big Bang to the rise of civilisation - how we got from there, being nothing at all, to here, being us. The ultimate eye-opening journey through time and space, revealing the world in a way most of us have never seen it before.<\/span>\n <a data-text-id=\"7114938112987720990\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_21').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_21').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_21').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_21').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_28789711"> <a href="/book/show/28789711-spqr"><img alt="SPQR: A History of Ancient Rome" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1470421195l/28789711.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_28789711'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/28789711-spqr?from_choice=false&amp;from_home_module=false\">SPQR: A History of Ancient Rome<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/97783.Mary_Beard\">Mary Beard<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.06 avg rating &mdash; 70,053 ratings<\/span> &mdash; published 2015\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer6287193926131497481\">In SPQR, an instant classic, Mary Beard narrates the history of Rome &quot;with passion and without technical jargon&quot; and demonstrates how &quot;a slightly shabby Iron Age village&quot; rose to become the &quot;undisputed hegemon of the Mediterranean&quot; (Wall Street Journal). Hailed by critics as animating &quot;the grand swe<\/span>\n <span id=\"freeText6287193926131497481\" style=\"display:none\">In SPQR, an instant classic, Mary Beard narrates the history of Rome &quot;with passion and without technical jargon&quot; and demonstrates how &quot;a slightly shabby Iron Age village&quot; rose to become the &quot;undisputed hegemon of the Mediterranean&quot; (Wall Street Journal). Hailed by critics as animating &quot;the grand sweep and the intimate details that bring the distant past vividly to life&quot; (Economist) in a way that makes &quot;your hair stand on end&quot; (Christian Science Monitor) and spanning nearly a thousand years of history, this &quot;highly informative, highly readable&quot; (Dallas Morning News) work examines not just how we think of ancient Rome but challenges the comfortable historical perspectives that have existed for centuries. With its nuanced attention to class, democratic struggles, and the lives of entire groups of people omitted from the historical narrative for centuries, SPQR will to shape our view of Roman history for decades to come.<\/span>\n <a data-text-id=\"6287193926131497481\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_28789711').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_28789711').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_28789711').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_28789711').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_767171"> <a href="/book/show/767171.The_Rise_and_Fall_of_the_Third_Reich"><img alt="The Rise and Fall of the Third Reich: A History of Nazi Germany" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1331223772l/767171.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_767171'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/767171.The_Rise_and_Fall_of_the_Third_Reich?from_choice=false&amp;from_home_module=false\">The Rise and Fall of the Third Reich: A History of Nazi Germany<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/13360.William_L_Shirer\">William L. Shirer<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.22 avg rating &mdash; 138,698 ratings<\/span> &mdash; published 1960\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer13138064570300452918\">Hitler boasted that The Third Reich would last a thousand years. It lasted only 12. But those 12 years contained some of the most catastrophic events Western civilization has ever known.No other powerful empire ever bequeathed such mountains of evidence about its birth and destruction as the Third R<\/span>\n <span id=\"freeText13138064570300452918\" style=\"display:none\">Hitler boasted that The Third Reich would last a thousand years. It lasted only 12. But those 12 years contained some of the most catastrophic events Western civilization has ever known.No other powerful empire ever bequeathed such mountains of evidence about its birth and destruction as the Third Reich. When the bitter war was over, and before the Nazis could destroy their files, the Allied demand for unconditional surrender produced an almost hour-by-hour record of the nightmare empire built by Adolph Hitler. This record included the testimony of Nazi leaders and of concentration camp inmates, the diaries of officials, transcripts of secret conferences, army orders, private letters—all the vast paperwork behind Hitler\'s drive to conquer the world.The famed foreign correspondent and historian William L. Shirer, who had watched and reported on the Nazis since 1925, spent five and a half years sifting through this massive documentation. The result is a monumental study that has been widely acclaimed as the definitive record of one of the most frightening chapters in the history of mankind.This worldwide bestseller has been acclaimed as the definitive book on Nazi Germany; it is a classic work.The accounts of how the United States got involved and how Hitler used Mussolini and Japan are astonishing, and the coverage of the war-from Germany\'s early successes to her eventual defeat-is must reading<\/span>\n <a data-text-id=\"13138064570300452918\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_767171').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_767171').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_767171').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_767171').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_39020"> <a href="/book/show/39020.1491"><img alt="1491: New Revelations of the Americas Before Columbus" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1545238592l/39020.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_39020'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/39020.1491?from_choice=false&amp;from_home_module=false\">1491: New Revelations of the Americas Before Columbus<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/22004.Charles_C_Mann\">Charles C. Mann<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.05 avg rating &mdash; 90,015 ratings<\/span> &mdash; published 2005\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer427241652675706693\">In this groundbreaking work of science, history, and archaeology, Charles C. Mann radically alters our understanding of the Americas before the arrival of Columbus in 1492.\n\nContrary to what so many Americans learn in school, the pre-Columbian Indians were not sparsely settled in a pristine wilderne<\/span>\n <span id=\"freeText427241652675706693\" style=\"display:none\">In this groundbreaking work of science, history, and archaeology, Charles C. Mann radically alters our understanding of the Americas before the arrival of Columbus in 1492.\n\nContrary to what so many Americans learn in school, the pre-Columbian Indians were not sparsely settled in a pristine wilderness; rather, there were huge numbers of Indians who actively molded and influenced the land around them. The astonishing Aztec capital of Tenochtitlan had running water and immaculately clean streets, and was larger than any contemporary European city. Mexican cultures created corn in a specialized breeding process that it has been called man’s first feat of genetic engineering. Indeed, Indians were not living lightly on the land but were landscaping and manipulating their world in ways that we are only now beginning to understand. Challenging and surprising, this a transformative new look at a rich and fascinating world we only thought we knew.<\/span>\n <a data-text-id=\"427241652675706693\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_39020').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_39020').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_39020').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_39020').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_193388249"> <a href="/book/show/193388249-killers-of-the-flower-moon"><img alt="Killers of the Flower Moon: The Osage Murders and the Birth of the FBI" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1696884539l/193388249._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_193388249'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/193388249-killers-of-the-flower-moon?from_choice=false&amp;from_home_module=false\">Killers of the Flower Moon: The Osage Murders and the Birth of the FBI<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1431785.David_Grann\">David Grann<\/a><span title=\"Goodreads Author!\">*<\/span>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.14 avg rating &mdash; 393,305 ratings<\/span> &mdash; published 2017\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer553180647364787639\">In the 1920s, the richest people per capita in the world were members of the Osage Nation in Oklahoma. After oil was discovered beneath their land, the Osage rode in chauffeured automobiles, built mansions, and sent their children to study in Europe.\n\nThen, one by one, the Osage began to be killed o<\/span>\n <span id=\"freeText553180647364787639\" style=\"display:none\">In the 1920s, the richest people per capita in the world were members of the Osage Nation in Oklahoma. After oil was discovered beneath their land, the Osage rode in chauffeured automobiles, built mansions, and sent their children to study in Europe.\n\nThen, one by one, the Osage began to be killed off. The family of an Osage woman, Mollie Burkhart, became a prime target. One of her relatives was shot. Another was poisoned. And this was just the beginning, as more and more Osage were dying under mysterious circumstances, and many of those who dared to investigate the killings were themselves murdered.\n\nAs the death toll rose, the newly created FBI took up the case, and the young director, J. Edgar Hoover, turned to a former Texas Ranger named Tom White to try to unravel the mystery. White put together an undercover team, including a Native American agent who infiltrated the region, and together with the Osage began to expose one of the most chilling conspiracies in American history.<\/span>\n <a data-text-id=\"553180647364787639\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_193388249').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_193388249').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_193388249').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_193388249').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_76401"> <a href="/book/show/76401.Bury_My_Heart_at_Wounded_Knee"><img alt="Bury My Heart at Wounded Knee: An Indian History of the American West" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1604058784l/76401._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_76401'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/76401.Bury_My_Heart_at_Wounded_Knee?from_choice=false&amp;from_home_module=false\">Bury My Heart at Wounded Knee: An Indian History of the American West<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/43443.Dee_Brown\">Dee Brown<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.25 avg rating &mdash; 96,127 ratings<\/span> &mdash; published 1970\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer14323888251373801858\">Now a special 30th-anniversary edition in both hardcover and paperback, the classic bestselling history The New York Times called &quot;Original, remarkable, and finally heartbreaking...Impossible to put down.&quot;\n\nBury My Heart at Wounded Knee is Dee Brown&apos;s eloquent, fully documented account of the system<\/span>\n <span id=\"freeText14323888251373801858\" style=\"display:none\">Now a special 30th-anniversary edition in both hardcover and paperback, the classic bestselling history The New York Times called &quot;Original, remarkable, and finally heartbreaking...Impossible to put down.&quot;\n\nBury My Heart at Wounded Knee is Dee Brown\'s eloquent, fully documented account of the systematic destruction of the American Indian during the second half of the nineteenth century. A national bestseller in hardcover for more than a year after its initial publication, it has sold almost four million copies and has been translated into seventeen languages. For this elegant thirtieth-anniversary edition—published in both hardcover and paperback—Brown has contributed an incisive new preface.\n\nUsing council records, autobiographies, and firsthand descriptions, Brown allows the great chiefs and warriors of the Dakota, Ute, Sioux, Cheyenne, and other tribes to tell us in their own words of the battles, massacres, and broken treaties that finally left them demoralized and defeated. A unique and disturbing narrative told with force and clarity, Bury My Heart at Wounded Knee changed forever our vision of how the West was really won.<\/span>\n <a data-text-id=\"14323888251373801858\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_76401').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_76401').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_76401').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_76401').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="coverRow "> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_2199"> <a href="/book/show/2199.Team_of_Rivals"><img alt="Team of Rivals: The Political Genius of Abraham Lincoln" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1676201263l/2199._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_2199'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/2199.Team_of_Rivals?from_choice=false&amp;from_home_module=false\">Team of Rivals: The Political Genius of Abraham Lincoln<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/1476.Doris_Kearns_Goodwin\">Doris Kearns Goodwin<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.28 avg rating &mdash; 190,976 ratings<\/span> &mdash; published 2005\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer8319735438175551907\">Winner of the Lincoln PrizeAcclaimed historian Doris Kearns Goodwin illuminates Lincoln&apos;s political genius in this highly original work, as the one-term congressman and prairie lawyer rises from obscurity to prevail over three gifted rivals of national reputation to become president.On May 18, 1860,<\/span>\n <span id=\"freeText8319735438175551907\" style=\"display:none\">Winner of the Lincoln PrizeAcclaimed historian Doris Kearns Goodwin illuminates Lincoln\'s political genius in this highly original work, as the one-term congressman and prairie lawyer rises from obscurity to prevail over three gifted rivals of national reputation to become president.On May 18, 1860, William H. Seward, Salmon P. Chase, Edward Bates, and Abraham Lincoln waited in their hometowns for the results from the Republican National Convention in Chicago. When Lincoln emerged as the victor, his rivals were dismayed and angry.Throughout the turbulent 1850s, each had energetically sought the presidency as the conflict over slavery was leading inexorably to secession and civil war. That Lincoln succeeded, Goodwin demonstrates, was the result of a character that had been forged by experiences that raised him above his more privileged and accomplished rivals. He won because he possessed an extraordinary ability to put himself in the place of other men, to experience what they were feeling, to understand their motives and desires.It was this capacity that enabled Lincoln as president to bring his disgruntled opponents together, create the most unusual cabinet in history, and marshal their talents to the task of preserving the Union and winning the war.We view the long, horrifying struggle from the vantage of the White House as Lincoln copes with incompetent generals, hostile congressmen, and his raucous cabinet. He overcomes these obstacles by winning the respect of his former competitors, and in the case of Seward, finds a loyal and crucial friend to see him through.This brilliant multiple biography is centered on Lincoln\'s mastery of men and how it shaped the most significant presidency in the nation\'s history.<\/span>\n <a data-text-id=\"8319735438175551907\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_2199').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_2199').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_2199').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_2199').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_8664353"> <a href="/book/show/8664353-unbroken"><img alt="Unbroken: A World War II Story of Survival, Resilience and Redemption" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1327861115l/8664353.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_8664353'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/8664353-unbroken?from_choice=false&amp;from_home_module=false\">Unbroken: A World War II Story of Survival, Resilience and Redemption<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/30913.Laura_Hillenbrand\">Laura Hillenbrand<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.39 avg rating &mdash; 965,101 ratings<\/span> &mdash; published 2010\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer6785726487610725377\">On a May afternoon in 1943, an Army Air Forces bomber crashed into the Pacific Ocean and disappeared, leaving only a spray of debris and a slick of oil, gasoline, and blood. Then, on the ocean surface, a face appeared. It was that of a young lieutenant, the plane&apos;s bombardier, who was struggling to <\/span>\n <span id=\"freeText6785726487610725377\" style=\"display:none\">On a May afternoon in 1943, an Army Air Forces bomber crashed into the Pacific Ocean and disappeared, leaving only a spray of debris and a slick of oil, gasoline, and blood. Then, on the ocean surface, a face appeared. It was that of a young lieutenant, the plane\'s bombardier, who was struggling to a life raft and pulling himself aboard. So began one of the most extraordinary odysseys of the Second World War.\n\nThe lieutenant’s name was Louis Zamperini. In boyhood, he\'d been a cunning and incorrigible delinquent, breaking into houses, brawling, and fleeing his home to ride the rails. As a teenager, he had channeled his defiance into running, discovering a prodigious talent that had carried him to the Berlin Olympics and within sight of the four-minute mile. But when war had come, the athlete had become an airman, embarking on a journey that led to his doomed flight, a tiny raft, and a drift into the unknown.\n\nAhead of Zamperini lay thousands of miles of open ocean, leaping sharks, a foundering raft, thirst and starvation, enemy aircraft, and, beyond, a trial even greater. Driven to the limits of endurance, Zamperini would answer desperation with ingenuity; suffering with hope, resolve, and humor; brutality with rebellion. His fate, whether triumph or tragedy, would be suspended on the fraying wire of his will.<\/span>\n <a data-text-id=\"6785726487610725377\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_8664353').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_8664353').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_8664353').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_8664353').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_40779082"> <a href="/book/show/40779082-the-guns-of-august"><img alt="The Guns of August" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1617037342l/40779082._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_40779082'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/40779082-the-guns-of-august?from_choice=false&amp;from_home_module=false\">The Guns of August<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/137261.Barbara_W_Tuchman\">Barbara W. Tuchman<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.18 avg rating &mdash; 79,333 ratings<\/span> &mdash; published 1962\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer6169017827593490880\">The Proud Tower, the Pulitzer Prize–winning The Guns of August, and The Zimmerman Telegram comprise Barbara W. Tuchman’s classic histories of the First World War era\n\nIn this landmark, Pulitzer Prize–winning account, renowned historian Barbara W. Tuchman re-creates the first month of World War I: th<\/span>\n <span id=\"freeText6169017827593490880\" style=\"display:none\">The Proud Tower, the Pulitzer Prize–winning The Guns of August, and The Zimmerman Telegram comprise Barbara W. Tuchman’s classic histories of the First World War era\n\nIn this landmark, Pulitzer Prize–winning account, renowned historian Barbara W. Tuchman re-creates the first month of World War I: thirty days in the summer of 1914 that determined the course of the conflict, the century, and ultimately our present world. Beginning with the funeral of Edward VII, Tuchman traces each step that led to the inevitable clash. And inevitable it was, with all sides plotting their war for a generation. Dizzyingly comprehensive and spectacularly portrayed with her famous talent for evoking the characters of the war’s key players, Tuchman’s magnum opus is a classic for the ages.<\/span>\n <a data-text-id=\"6169017827593490880\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_40779082').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_40779082').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_40779082').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_40779082').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_2203"> <a href="/book/show/2203.John_Adams"><img alt="John Adams" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1478144278l/2203._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_2203'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/2203.John_Adams?from_choice=false&amp;from_home_module=false\">John Adams<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/6281688.David_McCullough\">David McCullough<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.08 avg rating &mdash; 366,789 ratings<\/span> &mdash; published 2001\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer17946366287256335620\">The enthralling, often surprising story of John Adams, one of the most important and fascinating Americans who ever lived.\n\nIn this powerful, epic biography, David McCullough unfolds the adventurous life-journey of John Adams, the brilliant, fiercely independent, often irascible, always honest Yanke<\/span>\n <span id=\"freeText17946366287256335620\" style=\"display:none\">The enthralling, often surprising story of John Adams, one of the most important and fascinating Americans who ever lived.\n\nIn this powerful, epic biography, David McCullough unfolds the adventurous life-journey of John Adams, the brilliant, fiercely independent, often irascible, always honest Yankee patriot -- &quot;the colossus of independence,&quot; as Thomas Jefferson called him -- who spared nothing in his zeal for the American Revolution; who rose to become the second President of the United States and saved the country from blundering into an unnecessary war; who was learned beyond all but a few and regarded by some as &quot;out of his senses&quot;; and whose marriage to the wise and valiant Abigail Adams is one of the moving love stories in American history. \n\nLike his masterly, Pulitzer Prize-winning biography Truman, David McCullough\'s John Adams has the sweep and vitality of a great novel. It is both a riveting portrait of an abundantly human man and a vivid evocation of his time, much of it drawn from an outstanding collection of Adams family letters and diaries. In particular, the more than one thousand surviving letters between John and Abigail Adams, nearly half of which have never been published, provide extraordinary access to their private lives and make it possible to know John Adams as no other major American of his founding era. \n\nAs he has with stunning effect in his previous books, McCullough tells the story from within -- from the point of view of the amazing eighteenth century and of those who, caught up in events, had no sure way of knowing how things would turn out. George Washington, Benjamin Franklin, John Jay, the British spy Edward Bancroft, Madame Lafayette and Jefferson\'s Paris &quot;interest&quot; Maria Cosway, Alexander Hamilton, James Madison, the scandalmonger James Callender, Sally Hemings, John Marshall, Talleyrand, and Aaron Burr all figure in this panoramic chronicle, as does, importantly, John Quincy Adams, the adored son whom Adams would live to see become President. \n\nCrucial to the story, as it was to history, is the relationship between Adams and Jefferson, born opposites -- one a Massachusetts farmer\'s son, the other a Virginia aristocrat and slaveholder, one short and stout, the other tall and spare. Adams embraced conflict; Jefferson avoided it. Adams had great humor; Jefferson, very little. But they were alike in their devotion to their country. \n\nAt first they were ardent co-revolutionaries, then fellow diplomats and close friends. With the advent of the two political parties, they became archrivals, even enemies, in the intense struggle for the presidency in 1800, perhaps the most vicious election in history. Then, amazingly, they became friends again, and ultimately, incredibly, they died on the same day -- their day of days -- July 4, in the year 1826. \n\nMuch about John Adams\'s life will come as a surprise to many readers. His courageous voyage on the frigate Boston in the winter of 1778 and his later trek over the Pyrenees are exploits that few would have dared and that few readers will ever forget. \n\nIt is a life encompassing a huge arc -- Adams lived longer than any president. The story ranges from the Boston Massacre to Philadelphia in 1776 to the Versailles of Louis XVI, from Spain to Amsterdam, from the Court of St. James\'s, where Adams was the first American to stand before King George III as a representative of the new nation, to the raw, half-finished Capital by the Potomac, where Adams was the first President to occupy the White House. \n\nThis is history on a grand scale -- a book about politics and war and social issues, but also about human nature, love, religious faith, virtue, ambition, friendship and betrayal, and the far-reaching consequences of noble ideas. Above all, John Adams is an enthralling, often surprising story of one of the most important and fascinating Americans who ever lived.<\/span>\n <a data-text-id=\"17946366287256335620\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'leftMiddle', hook: { tip: 'leftMiddle', target: 'rightMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_2203').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_2203').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_2203').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_2203').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="leftAlignedImage bookBox"> <div class="coverWrapper" id="bookCover175293_40718726"> <a href="/book/show/40718726-genghis-khan-and-the-making-of-the-modern-world"><img alt="Genghis Khan and the Making of the Modern World" title="" width="115" class="bookImage" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/books/1530716694l/40718726._SY475_.jpg" /></a> </div> <script> //<![CDATA[ var newTip = new Tip($('bookCover175293_40718726'), "\n\n <h2><a class=\"readable bookTitle\" href=\"https://www.goodreads.com/book/show/40718726-genghis-khan-and-the-making-of-the-modern-world?from_choice=false&amp;from_home_module=false\">Genghis Khan and the Making of the Modern World<\/a><\/h2>\n\n <div>\n by <a class=\"authorName\" href=\"/author/show/2497.Jack_Weatherford\">Jack Weatherford<\/a>\n <\/div>\n\n <div class=\"smallText uitext darkGreyText\">\n <span class=\"minirating\"><span class=\"stars staticStars notranslate\"><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p10\"><\/span><span size=\"12x12\" class=\"staticStar p3\"><\/span><\/span> 4.06 avg rating &mdash; 77,048 ratings<\/span> &mdash; published 2004\n <\/div>\n\n <div class=\"addBookTipDescription\">\n \n<span id=\"freeTextContainer163572564543166149\">The name Genghis Khan often conjures the image of a relentless, bloodthirsty barbarian on horseback leading a ruthless band of nomadic warriors in the looting of the civilized world. But the surprising truth is that Genghis Khan was a visionary leader whose conquests joined backward Europe with the <\/span>\n <span id=\"freeText163572564543166149\" style=\"display:none\">The name Genghis Khan often conjures the image of a relentless, bloodthirsty barbarian on horseback leading a ruthless band of nomadic warriors in the looting of the civilized world. But the surprising truth is that Genghis Khan was a visionary leader whose conquests joined backward Europe with the flourishing cultures of Asia to trigger a global awakening, an unprecedented explosion of technologies, trade, and ideas. In Genghis Khan and the Making of the Modern World, Jack Weatherford, the only Western scholar ever to be allowed into the Mongols’ “Great Taboo”—Genghis Khan’s homeland and forbidden burial site—tracks the astonishing story of Genghis Khan and his descendants, and their conquest and transformation of the world. \n\nFighting his way to power on the remote steppes of Mongolia, Genghis Khan developed revolutionary military strategies and weaponry that emphasized rapid attack and siege warfare, which he then brilliantly used to overwhelm opposing armies in Asia, break the back of the Islamic world, and render the armored knights of Europe obsolete. Under Genghis Khan, the Mongol army never numbered more than 100,000 warriors, yet it subjugated more lands and people in twenty-five years than the Romans conquered in four hundred. With an empire that stretched from Siberia to India, from Vietnam to Hungary, and from Korea to the Balkans, the Mongols dramatically redrew the map of the globe, connecting disparate kingdoms into a new world order. \n\nBut contrary to popular wisdom, Weatherford reveals that the Mongols were not just masters of conquest, but possessed a genius for progressive and benevolent rule. On every level and from any perspective, the scale and scope \nof Genghis Khan’s accomplishments challenge the limits of imagination. Genghis Khan was an innovative leader, the first ruler in many conquered countries to put the power of law above his own power, encourage religious freedom, create public schools, grant diplomatic immunity, abolish torture, and institute free trade. The trade routes he created became lucrative pathways for commerce, but also for ideas, technologies, and expertise that transformed the way people lived. The Mongols introduced the first international paper currency and postal system and developed and spread revolutionary technologies like printing, the cannon, compass, and abacus. They took local foods and products like lemons, carrots, noodles, tea, rugs, playing cards, and pants and turned them into staples of life around the world. The Mongols were the architects of a new way of life at a pivotal time in history. \n\nIn Genghis Khan and the Making of the Modern World, Jack Weatherford resurrects the true history of Genghis Khan, from the story of his relentless rise through Mongol tribal culture to the waging of his devastatingly successful wars and the explosion of civilization that the Mongol Empire unleashed. This dazzling work of revisionist history doesn’t just paint an unprecedented portrait of a great leader and his legacy, but challenges us to reconsider how the modern world was made.\n\n\nFrom the Hardcover edition.<\/span>\n <a data-text-id=\"163572564543166149\" href=\"#\" onclick=\"swapContent(\$(this));; return false;\">...more<\/a>\n\n <\/div>\n\n\n", { style: 'addbook', stem: 'rightMiddle', hook: { tip: 'rightMiddle', target: 'leftMiddle' }, hideOn: false, width: 400, hideAfter: 0.05, delay: 0.35 }); $('bookCover175293_40718726').observe('prototip:shown', function() { if (this.up('#box')) { $$('div.prototip').each(function(i){i.setStyle({zIndex: $('box').getStyle('z-index')})}); } else { $$('div.prototip').each(function(i){i.setStyle({zIndex: 6000})}); } }); newTip['wrapper'].addClassName('prototipAllowOverflow'); $('bookCover175293_40718726').observe('prototip:shown', function () { $$('div.prototip').each(function (e) { if ($('bookCover175293_40718726').hasClassName('ignored')) { e.setStyle({'display': 'none'}); return; } e.setStyle({'overflow': 'visible'}); }); }); $('bookCover175293_40718726').observe('prototip:hidden', function () { $$('span.elementTwo').each(function (e) { if (e.getStyle('display') !== 'none') { var lessLink = e.next(); swapContent(lessLink); } }); }); //]]> </script> </div> <div class="clear"></div> </div> <div class="clear"></div> <div class="moreLink"> <a class="actionLink" href="/shelf/show/history">More history books...</a> </div> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> </div> <div class="rightContainer"> <div data-react-class="ReactComponents.GoogleBannerAd" data-react-props="{&quot;adId&quot;:&quot;&quot;,&quot;className&quot;:&quot;googleBannerAd--mediumRectangle&quot;}"></div> <div data-react-class="ReactComponents.GoogleFeaturedContentModule" data-react-props="{&quot;adId&quot;:&quot;&quot;,&quot;trackingOptions&quot;:{&quot;enableTracking&quot;:true,&quot;adId&quot;:&quot;&quot;},&quot;isMobile&quot;:false,&quot;isInline&quot;:false,&quot;hasBottomBorder&quot;:false}"></div> <br> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground">Related Genres</h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="left" style="width: 50%"> <a class="gr-hyperlink" href="/genres/non-fiction">Nonfiction</a><br> <a class="gr-hyperlink" href="/genres/american-history">American History</a><br> <a class="gr-hyperlink" href="/genres/world-history">World History</a><br> <a class="gr-hyperlink" href="/genres/european-history">European History</a><br> <a class="gr-hyperlink" href="/genres/world-war-ii">World War II</a><br> <a class="gr-hyperlink" href="/genres/middle-ages">Middle Ages</a><br> <a class="gr-hyperlink" href="/genres/world-war-i">World War I</a><br> </div> <div class="left" style="width: 50%"> <a class="gr-hyperlink" href="/genres/microhistory">Microhistory</a><br> <a class="gr-hyperlink" href="/genres/prehistory">Prehistory</a><br> <a class="gr-hyperlink" href="/genres/food-history">Food History</a><br> <a class="gr-hyperlink" href="/genres/latin-american-history">Latin American History</a><br> <a class="gr-hyperlink" href="/genres/oral-history">Oral History</a><br> <a class="gr-hyperlink" href="/genres/indigenous-history">Indigenous History</a><br> </div> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div data-react-class="ReactComponents.GoogleBannerAd" data-react-props="{&quot;adId&quot;:&quot;&quot;,&quot;className&quot;:&quot;googleBannerAd--mediumRectangle&quot;}"></div> <div data-react-class="ReactComponents.NewsPreview" data-react-props="{&quot;sectionHeader&quot;:&quot;Related News&quot;,&quot;isMobile&quot;:false,&quot;isBookPage&quot;:false,&quot;imageOnLeft&quot;:true,&quot;showLikesComments&quot;:false,&quot;newsItems&quot;:[{&quot;newsUrl&quot;:&quot;https://www.goodreads.com/blog/show/2847-6-new-books-recommended-by-readers-this-week?ref=genres-show&quot;,&quot;excerpt&quot;:&quot;\nNeed another excuse to treat yourself to a new book this week? We&#39;ve got you covered with the buzziest new releases of the day, according to early...&quot;,&quot;title&quot;:&quot;6 New Books Recommended by Readers This Week&quot;,&quot;newsImageUrl&quot;:&quot;https://images.gr-assets.com/blogs/1729805012p8/2847.jpg&quot;,&quot;authorImageUrl&quot;:null,&quot;bookImageUrl&quot;:null,&quot;key&quot;:&quot;kca://blog/amzn1.gr.blog.v3.Dpo_Ba-1jZrSd2DK&quot;}]}"><div class="bigBox clearFloats" data-reactid=".1346y2cxmza" data-react-checksum="497258548"><div class="h2Container gradientHeaderContainer" data-reactid=".1346y2cxmza.0"><h2 class="brownBackground" data-reactid=".1346y2cxmza.0.0">Related News</h2></div><div class="newsPreview__item" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK"><div data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.0"><a href="https://www.goodreads.com/blog/show/2847-6-new-books-recommended-by-readers-this-week?ref=genres-show" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.0.0"><img class="newsPreview__newsImage" src="https://images.gr-assets.com/blogs/1729805012p8/2847.jpg" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.0.0.0"/></a></div><div class="newsPreview__textSection" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.1"><div data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.1.0"><a class="gr-h4 gr-h4--serif newsPreview__newsHeader" href="https://www.goodreads.com/blog/show/2847-6-new-books-recommended-by-readers-this-week?ref=genres-show" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.1.0.0">6 New Books Recommended by Readers This Week</a></div><div class="newsPreview__excerpt" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.1.1"> Need another excuse to treat yourself to a new book this week? We've got you covered with the buzziest new releases of the day, according to early...</div><div class="newsPreview__readMore" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.1.2"><a href="https://www.goodreads.com/blog/show/2847-6-new-books-recommended-by-readers-this-week?ref=genres-show" data-reactid=".1346y2cxmza.1:$kca=2//blog/amzn1=1gr=1blog=1v3=1Dpo_Ba-1jZrSd2DK.1.2.0">Read more...</a></div></div></div></div></div> <!-- romance gets treated differently to improve SEO --> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/quotes/show_tag?name=history">Quotes Tagged “History”</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="quote mediumText "> <div class="quoteDetails fullLine"> <a class="leftAlignedImage quoteAvatar " href="/author/show/8349.Christopher_Paolini"> <img alt="Christopher Paolini" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/authors/1591638024i/8349._UX200_CR0,50,200,200_.jpg" /> </a> <div class="quoteText"> &ldquo; <span id="freeTextContainer14907870091011139442">People have an annoying habit of remembering things they shouldn&apos;t.</span> <span id="freeText14907870091011139442" style="display:none">People have an annoying habit of remembering things they shouldn't.</span> <a data-text-id="14907870091011139442" href="#" onclick="swapContent($(this));; return false;">...more</a> &rdquo; <br /> &#8213; <span class="authorOrTitle"> Christopher Paolini, </span> <span id=quote_book_link_113436> <a class="authorOrTitle" href="/work/quotes/3178011">Eragon</a> </span> </div> <div class="quoteFooter"> <div class="right"> <a class="smallText" title="View this quote" href="/quotes/139954-people-have-an-annoying-habit-of-remembering-things-they-shouldn-t">1988 likes</a> </div> </div> </div> <br class="clear"/> </div> <div class="quote mediumText last"> <div class="quoteDetails fullLine"> <a class="leftAlignedImage quoteAvatar " href="/author/show/1113469.Hermann_Hesse"> <img alt="Hermann Hesse" src="https://i.gr-assets.com/images/S/compressed.photo.goodreads.com/authors/1499981916i/1113469._UX200_CR0,31,200,200_.jpg" /> </a> <div class="quoteText"> &ldquo; <span id="freeTextContainer14874322033873296285">For me, trees have always been the most penetrating preachers. I revere them when they live in tribes and families, in forests and groves. And even more I revere them when they stand alone. They are like lonely persons. Not like hermits who have stolen away out of some weakness, but like great, solitary men, like Beethoven and Nietzsche. In their highest boughs the world rustles, their roots rest in infinity; but they do not lose themselves there, they struggle with all the force of their lives </span> <span id="freeText14874322033873296285" style="display:none">For me, trees have always been the most penetrating preachers. I revere them when they live in tribes and families, in forests and groves. And even more I revere them when they stand alone. They are like lonely persons. Not like hermits who have stolen away out of some weakness, but like great, solitary men, like Beethoven and Nietzsche. In their highest boughs the world rustles, their roots rest in infinity; but they do not lose themselves there, they struggle with all the force of their lives for one thing only: to fulfil themselves according to their own laws, to build up their own form, to represent themselves. Nothing is holier, nothing is more exemplary than a beautiful, strong tree. When a tree is cut down and reveals its naked death-wound to the sun, one can read its whole history in the luminous, inscribed disk of its trunk: in the rings of its years, its scars, all the struggle, all the suffering, all the sickness, all the happiness and prosperity stand truly written, the narrow years and the luxurious years, the attacks withstood, the storms endured. And every young farmboy knows that the hardest and noblest wood has the narrowest rings, that high on the mountains and in continuing danger the most indestructible, the strongest, the ideal trees grow. Trees are sanctuaries. Whoever knows how to speak to them, whoever knows how to listen to them, can learn the truth. They do not preach learning and precepts, they preach, undeterred by particulars, the ancient law of life. A tree says: A kernel is hidden in me, a spark, a thought, I am life from eternal life. The attempt and the risk that the eternal mother took with me is unique, unique the form and veins of my skin, unique the smallest play of leaves in my branches and the smallest scar on my bark. I was made to form and reveal the eternal in my smallest special detail. A tree says: My strength is trust. I know nothing about my fathers, I know nothing about the thousand children that every year spring out of me. I live out the secret of my seed to the very end, and I care for nothing else. I trust that God is in me. I trust that my labor is holy. Out of this trust I live. When we are stricken and cannot bear our lives any longer, then a tree has something to say to us: Be still! Be still! Look at me! Life is not easy, life is not difficult. Those are childish thoughts. Let God speak within you, and your thoughts will grow silent. You are anxious because your path leads away from mother and home. But every step and every day lead you back again to the mother. Home is neither here nor there. Home is within you, or home is nowhere at all. A longing to wander tears my heart when I hear trees rustling in the wind at evening. If one listens to them silently for a long time, this longing reveals its kernel, its meaning. It is not so much a matter of escaping from one's suffering, though it may seem to be so. It is a longing for home, for a memory of the mother, for new metaphors for life. It leads home. Every path leads homeward, every step is birth, every step is death, every grave is mother. So the tree rustles in the evening, when we stand uneasy before our own childish thoughts: Trees have long thoughts, long-breathing and restful, just as they have longer lives than ours. They are wiser than we are, as long as we do not listen to them. But when we have learned how to listen to trees, then the brevity and the quickness and the childlike hastiness of our thoughts achieve an incomparable joy. Whoever has learned how to listen to trees no longer wants to be a tree. He wants to be nothing except what he is. That is home. That is happiness.</span> <a data-text-id="14874322033873296285" href="#" onclick="swapContent($(this));; return false;">...more</a> &rdquo; <br /> &#8213; <span class="authorOrTitle"> Herman Hesse, </span> <span id=quote_book_link_1552368> <a class="authorOrTitle" href="/work/quotes/2225608">Bäume: Betrachtungen und Gedichte</a> </span> </div> <div class="quoteFooter"> <div class="right"> <a class="smallText" title="View this quote" href="/quotes/27688-for-me-trees-have-always-been-the-most-penetrating-preachers">4934 likes</a> </div> </div> </div> <br class="clear"/> </div> <a class="actionLink" style="float: right" href="/quotes/show_tag?name=history">More quotes...</a> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/videos/show_tag?name=history">Videos Tagged “History”</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> <div class="elementList" style="width: 100%"> <div style="float: left; padding-right: 10px"> <div class="videoThumbnail" data-source="youtube" data-source-id="GX-aEcF8Rjg" data-goodreads-id="28492"><a href="/videos/28492-shadow-government---puppet-masters-pulling-strings-the-ninth-orphan"><img alt="Shadow Government - Puppet Masters Pulling Strings (The Ninth Orphan)" src="https://i.ytimg.com/vi/GX-aEcF8Rjg/default.jpg" /></a><a class="playIcon" href="/videos/28492-shadow-government---puppet-masters-pulling-strings-the-ninth-orphan"></a></div> </div> <a class="videoTitle" href="/videos/28492-shadow-government---puppet-masters-pulling-strings-the-ninth-orphan">Shadow Government - Puppet Masters Pulling Strings (The Ninth Orphan)</a> <br class="clear" /> </div> <div class="elementList" style="width: 100%"> <div style="float: left; padding-right: 10px"> <div class="videoThumbnail" data-source="youtube" data-source-id="tsFxH2zdi_Y" data-goodreads-id="2789"><a href="/videos/2789-did-coffee-fuel-the-age-of-enlightenment---steven-johnson"><img alt="Did Coffee Fuel the Age of Enlightenment? - Steven Johnson" src="https://i.ytimg.com/vi/tsFxH2zdi_Y/default.jpg" /></a><a class="playIcon" href="/videos/2789-did-coffee-fuel-the-age-of-enlightenment---steven-johnson"></a></div> </div> <a class="videoTitle" href="/videos/2789-did-coffee-fuel-the-age-of-enlightenment---steven-johnson">Did Coffee Fuel the Age of Enlightenment? - Steven Johnson</a> <br class="clear" /> </div> <a class="actionLink" style="float: right" href="/videos/show_tag?name=history">More videos...</a> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div data-react-class="ReactComponents.GoogleBannerAd" data-react-props="{&quot;adId&quot;:&quot;&quot;,&quot;className&quot;:&quot;googleBannerAd--mediumRectangle&quot;}"></div> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground"><a href="/group/show_tag/history?name=history">Groups Tagged &quot;History&quot;</a></h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent" id="&lt;ahref=&quot;/group/show_tag/history?name=history&quot;&gt;GroupsTagged&amp;quot;History&amp;quot;&lt;/a&gt;"> <div class="smallListEntry"> <div> <a class="groupName header14 serif" href="/group/show/1253698-journey-of-thought">Journey of Thought </a> </div> <a title="Journey of Thought " class="leftAlignedImage smallListImage" href="/group/show/1253698-journey-of-thought"><img width="30" alt="Journey of Thought " src="https://images.gr-assets.com/groups/1728258741p2/1253698.jpg" /></a> Welcome to Matthew P. Calder’s Book Club! I’m excited to invite you on a personal and philosoph<a id="freeTextLinkgroup__1253698" href="#" onclick="$j(&#39;#freeTextgroup__1253698&#39;).toggle(); return false;">&hellip;more</a> <div class="floatingBox" id="freeTextgroup__1253698" style="display: none; width: 450px; padding: 20px 40px 20px 40px"> <a class=" closeLink" href="#" onclick="$j(&#39;#freeTextgroup__1253698&#39;).toggle(); return false;">[close]</a> Welcome to Matthew P. Calder’s Book Club! I’m excited to invite you on a personal and philosophical journey through our new book club. Together, we’ll explore a wide range of themes, including philosophy, personal growth, history, and how we navigate the complexities of our world. Every two weeks, I’ll introduce a new book for us to read and discuss, starting on October 14th. This book club is open to everyone, and you’re welcome to participate however it suits you—join in for every book or move in and out as you like. We’ll have discussions on Reddit and share updates on Instagram, so feel free to connect with us there: • Join the discussion on Reddit: https://www.reddit.com/r/JourneyofThought/s/vXomVL2xSq • Follow updates on Instagram: https://www.instagram.com/p/DAydM-ZxlTK/?igsh=MXRtcjI5NTU3bTdqdQ== Let’s learn, grow, and explore together. I look forward to seeing you on this journey! </div> <div class="greyText statistics"> 2 members, last active 2 months ago </div> </div> <div class="smallListEntry"> <div> <a class="groupName header14 serif" href="/group/show/162558-nonfiction-pulitzers">NonFiction Pulitzers</a> </div> <a title="NonFiction Pulitzers" class="leftAlignedImage smallListImage" href="/group/show/162558-nonfiction-pulitzers"><img width="30" alt="NonFiction Pulitzers" src="https://images.gr-assets.com/groups/1431194758p2/162558.jpg" /></a> A group to read the General Nonfiction, Biography/Autobiography, and History Books that won or w<a id="freeTextLinkgroup__162558" href="#" onclick="$j(&#39;#freeTextgroup__162558&#39;).toggle(); return false;">&hellip;more</a> <div class="floatingBox" id="freeTextgroup__162558" style="display: none; width: 450px; padding: 20px 40px 20px 40px"> <a class=" closeLink" href="#" onclick="$j(&#39;#freeTextgroup__162558&#39;).toggle(); return false;">[close]</a> A group to read the General Nonfiction, Biography/Autobiography, and History Books that won or were a finalist for the Pulitzer Prize. </div> <div class="greyText statistics"> 775 members, last active an hour ago </div> </div> <div class="smallListEntry"> <div> <a class="groupName header14 serif" href="/group/show/167512-world-writing-wealth">World, Writing, Wealth</a> </div> <a title="World, Writing, Wealth" class="leftAlignedImage smallListImage" href="/group/show/167512-world-writing-wealth"><img width="30" alt="World, Writing, Wealth" src="https://images.gr-assets.com/groups/1696837244p2/167512.jpg" /></a> Friends, would you care to partake in a learned discussion of current events, the global economy<a id="freeTextLinkgroup__167512" href="#" onclick="$j(&#39;#freeTextgroup__167512&#39;).toggle(); return false;">&hellip;more</a> <div class="floatingBox" id="freeTextgroup__167512" style="display: none; width: 450px; padding: 20px 40px 20px 40px"> <a class=" closeLink" href="#" onclick="$j(&#39;#freeTextgroup__167512&#39;).toggle(); return false;">[close]</a> Friends, would you care to partake in a learned discussion of current events, the global economy, writing, selling, film, and reading? Then gift us with the honor of your sophisticated opinions, queries and humor on board our trireme of World, Writing and Wealth and sail the seven seas with us! </div> <div class="greyText statistics"> 4,523 members, last active a day ago </div> </div> <div class="smallListEntry"> <div> <a class="groupName header14 serif" href="/group/show/1257383-al-asas-islamic-book-club">Al-asas Islamic book club</a> </div> <a title="Al-asas Islamic book club" class="leftAlignedImage smallListImage" href="/group/show/1257383-al-asas-islamic-book-club"><img width="30" alt="Al-asas Islamic book club" src="https://images.gr-assets.com/groups/1733069401p2/1257383.jpg" /></a> We are a book group focused on discussing books written on Islam and Muslims and books written b<a id="freeTextLinkgroup__1257383" href="#" onclick="$j(&#39;#freeTextgroup__1257383&#39;).toggle(); return false;">&hellip;more</a> <div class="floatingBox" id="freeTextgroup__1257383" style="display: none; width: 450px; padding: 20px 40px 20px 40px"> <a class=" closeLink" href="#" onclick="$j(&#39;#freeTextgroup__1257383&#39;).toggle(); return false;">[close]</a> We are a book group focused on discussing books written on Islam and Muslims and books written by Muslim authors </div> <div class="greyText statistics"> 3 members, last active 4 days ago </div> </div> <div> <a class="actionLink listMoreLink" href="/group/show_tag/history?name=history">More&hellip;</a> </div> <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div> <div class=" clearFloats bigBox"><div class="h2Container gradientHeaderContainer"><h2 class="brownBackground">Tags</h2></div><div class="bigBoxBody"><div class="bigBoxContent containerWithHeaderContent"> Tags contributing to this page include: history, past, and storia <div class="clear"></div></div></div><div class="bigBoxBottom"></div></div></div> </div> <div class="clear"></div> </div> <div class="clear"></div> </div> <div data-react-class="ReactComponents.GooglePageSkin" data-react-props="{&quot;adId&quot;:&quot;&quot;,&quot;trackingOptions&quot;:{&quot;enableTracking&quot;:true,&quot;adId&quot;:&quot;&quot;}}"></div> <div class="clear"></div> <footer class='responsiveSiteFooter'> <div class='responsiveSiteFooter__contents gr-container-fluid'> <div class='gr-row'> <div class='gr-col gr-col-md-8 gr-col-lg-6'> <div class='gr-row'> <div class='gr-col-md-3 gr-col-lg-4'> <h3 class='responsiveSiteFooter__heading'>Company</h3> <ul class='responsiveSiteFooter__linkList'> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/about/us">About us</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/jobs">Careers</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/about/terms">Terms</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/about/privacy">Privacy</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="https://help.goodreads.com/s/article/Goodreads-Interest-Based-Ads-Notice">Interest Based Ads</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/adprefs">Ad Preferences</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/help?action_type=help_web_footer">Help</a> </li> </ul> </div> <div class='gr-col-md-4 gr-col-lg-4'> <h3 class='responsiveSiteFooter__heading'>Work with us</h3> <ul class='responsiveSiteFooter__linkList'> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/author/program">Authors</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/advertisers">Advertise</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/news?content_type=author_blogs">Authors &amp; ads blog</a> </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/api">API</a> </li> </ul> </div> <div class='gr-col-md-5 gr-col-lg-4'> <h3 class='responsiveSiteFooter__heading'>Connect</h3> <div class='responsiveSiteFooter__socialLinkWrapper'> <a class="responsiveSiteFooter__socialLink" rel="noopener noreferrer" href="https://www.facebook.com/Goodreads/"><img alt="Goodreads on Facebook" src="https://s.gr-assets.com/assets/site_footer/footer_facebook-ea4ab848f8e86c5f5c98311bc9495a1b.svg" /> </a><a class="responsiveSiteFooter__socialLink" rel="noopener noreferrer" href="https://twitter.com/goodreads"><img alt="Goodreads on Twitter" src="https://s.gr-assets.com/assets/site_footer/footer_twitter-126b3ee80481a763f7fccb06ca03053c.svg" /> </a></div> <div class='responsiveSiteFooter__socialLinkWrapper'> <a class="responsiveSiteFooter__socialLink" rel="noopener noreferrer" href="https://www.instagram.com/goodreads/"><img alt="Goodreads on Instagram" src="https://s.gr-assets.com/assets/site_footer/footer_instagram-d59e3887020f12bcdb12e6c539579d85.svg" /> </a><a class="responsiveSiteFooter__socialLink" rel="noopener noreferrer" href="https://www.linkedin.com/company/goodreads-com/"><img alt="Goodreads on LinkedIn" src="https://s.gr-assets.com/assets/site_footer/footer_linkedin-5b820f4703eff965672594ef4d10e33c.svg" /> </a></div> </div> </div> </div> <div class='gr-col gr-col-md-4 gr-col-lg-6 responsiveSiteFooter__appLinksColumn'> <div class='responsiveSiteFooter__appLinksColumnContents'> <div class='responsiveSiteFooter__appLinksColumnBadges'> <a href="https://itunes.apple.com/app/apple-store/id355833469?pt=325668&amp;ct=mw_footer&amp;mt=8"><img alt="Download app for iOS" src="https://s.gr-assets.com/assets/app/badge-ios-desktop-homepage-6ac7ae16eabce57f6c855361656a7540.svg" /> </a><a href="https://play.google.com/store/apps/details?id=com.goodreads&amp;utm_source=mw_footer&amp;pcampaignid=MKT-Other-global-all-co-prtnr-py-PartBadge-Mar2515-1"><img alt="Download app for Android" srcSet="https://s.gr-assets.com/assets/app/badge-android-desktop-home-2x-e31514e1fb4dddecf9293aa526a64cfe.png 2x" src="https://s.gr-assets.com/assets/app/badge-android-desktop-home-0f517cbae4d56c88a128d27a7bea1118.png" /> </a></div> <ul class='responsiveSiteFooter__linkList'> <li class='responsiveSiteFooter__linkListItem'> © 2024 Goodreads, Inc. </li> <li class='responsiveSiteFooter__linkListItem'> <a class="responsiveSiteFooter__link" href="/toggle_mobile">Mobile version </a></li> </ul> </div> </div> </div> </div> </footer> <script> //<![CDATA[ if (typeof window.uet == 'function') { window.uet('be'); } //]]> </script> </div> <!-- This partial loads on almost every page view. The associated React component makes a call to SignInPromptController#get to determine if the user should see the sign in interstial. This is determined by how many signed out pagehits the user has executed an how recently they have last seen the insterstitial. If the controller responds indicating the popup should appear, the React component will render its content. --> <div data-react-class="ReactComponents.LoginInterstitial" data-react-props="{&quot;allowFacebookSignIn&quot;:true,&quot;allowAmazonSignIn&quot;:true,&quot;overrideSignedOutPageCount&quot;:false,&quot;path&quot;:{&quot;signInUrl&quot;:&quot;/user/sign_in&quot;,&quot;signUpUrl&quot;:&quot;/user/sign_up&quot;,&quot;privacyUrl&quot;:&quot;/about/privacy&quot;,&quot;termsUrl&quot;:&quot;/about/terms&quot;,&quot;thirdPartyRedirectUrl&quot;:&quot;/user/new?connect_prompt=true&quot;}}"><noscript data-reactid=".26qas5b0nvo" data-react-checksum="-1249963711"></noscript></div> <div id="overlay" style="display:none" onclick="Lightbox.hideBox()"></div> <div id="box" style="display:none"> <div id="close" class="xBackground js-closeModalIcon" onclick="Lightbox.hideBox()" title="Close this window"></div> <div id="boxContents"></div> <div id="boxContentsLeftovers" style="display:none"></div> <div class="clear"></div> </div> <div id="fbSigninNotification" style="display:none;"> <p>Welcome back. Just a moment while we sign you in to your Goodreads account.</p> <img src="https://s.gr-assets.com/assets/facebook/login_animation-085464711e6c1ed5ba287a2f40ba3343.gif" alt="Login animation" /> </div> <script> //<![CDATA[ qcdata = {} || qcdata; (function(){ var elem = document.createElement('script'); elem.src = (document.location.protocol == "https:" ? "https://secure" : "http://pixel") + ".quantserve.com/aquant.js?a=p-0dUe_kJAjvkoY"; elem.async = true; elem.type = "text/javascript"; var scpt = document.getElementsByTagName('script')[0]; scpt.parentNode.insertBefore(elem,scpt); }()); var qcdata = {qacct: 'p-0dUe_kJAjvkoY'}; //]]> </script> <noscript> <img alt='Quantcast' border='0' height='1' src='//pixel.quantserve.com/pixel/p-0dUe_kJAjvkoY.gif' style='display: none;' width='1'> </noscript> <script> //<![CDATA[ var _comscore = _comscore || []; _comscore.push({ c1: "2", c2: "6035830", c3: "", c4: "", c5: "", c6: "", c15: ""}); (function() { var s = document.createElement("script"), el = document.getElementsByTagName("script")[0]; s.async = true; s.src = (document.location.protocol == "https:" ? "https://sb" : "http://b") + ".scorecardresearch.com/beacon.js"; el.parentNode.insertBefore(s, el); })(); //]]> </script> <noscript> <img style="display: none" width="0" height="0" alt="" src="https://sb.scorecardresearch.com/p?c1=2&amp;amp;c2=6035830&amp;amp;c3=&amp;amp;c4=&amp;amp;c5=&amp;amp;c6=&amp;amp;c15=&amp;amp;cv=2.0&amp;amp;cj=1" /> </noscript> <script> //<![CDATA[ window.addEventListener("DOMContentLoaded", function() { ReactStores.GoogleAdsStore.initializeWith({"targeting":{"sid":"osid.d92a6d71b2d273571fea7a0b37c9286b","grsession":"osid.d92a6d71b2d273571fea7a0b37c9286b","surface":"desktop","signedin":"false","gr_author":"false","author":[],"shelf":["history","past","storia"],"tags":["48","27171","106962"],"gtargeting":"27wr29","resource":"genre_history"},"ads":{},"nativeAds":{}}); ReactStores.NotificationsStore.updateWith({}); ReactStores.CurrentUserStore.initializeWith({"currentUser":null}); ReactStores.FavoriteGenresStore.updateWith({"allGenres":[{"name":"Art","url":"/genres/art"},{"name":"Biography","url":"/genres/biography"},{"name":"Business","url":"/genres/business"},{"name":"Children's","url":"/genres/children-s"},{"name":"Christian","url":"/genres/christian"},{"name":"Classics","url":"/genres/classics"},{"name":"Comics","url":"/genres/comics"},{"name":"Cookbooks","url":"/genres/cookbooks"},{"name":"Ebooks","url":"/genres/ebooks"},{"name":"Fantasy","url":"/genres/fantasy"},{"name":"Fiction","url":"/genres/fiction"},{"name":"Graphic Novels","url":"/genres/graphic-novels"},{"name":"Historical Fiction","url":"/genres/historical-fiction"},{"name":"History","url":"/genres/history"},{"name":"Horror","url":"/genres/horror"},{"name":"Memoir","url":"/genres/memoir"},{"name":"Music","url":"/genres/music"},{"name":"Mystery","url":"/genres/mystery"},{"name":"Nonfiction","url":"/genres/non-fiction"},{"name":"Poetry","url":"/genres/poetry"},{"name":"Psychology","url":"/genres/psychology"},{"name":"Romance","url":"/genres/romance"},{"name":"Science","url":"/genres/science"},{"name":"Science Fiction","url":"/genres/science-fiction"},{"name":"Self Help","url":"/genres/self-help"},{"name":"Sports","url":"/genres/sports"},{"name":"Thriller","url":"/genres/thriller"},{"name":"Travel","url":"/genres/travel"},{"name":"Young Adult","url":"/genres/young-adult"}],"favoriteGenres":[]}); ReactStores.TabsStore.updateWith({"communitySpotlight":"groups"}); }); //]]> </script> </body> </html> <!-- This is a random-length HTML comment: ujruhhwbzlluastcsgpssxluanfmtcbycfiksmuphgvfftiasapibjarrpfzonvzbkbmzjrnvrgpwjlydaawwmrcwklncttgjhsfzyxnaccjkjojrcnlapvwlpzkbsizrrjoyzqmgpfvnrosmraxdwkutcuqxneouppcuerlcneynazcwejomngkididnbqphvmqcxptytrfokegbgfqyasbhvuyybjqgtnzjparqgcqihudhehoiodvpmzbchrlczcnzbqxpanzfufzocnzeduoqwmqjxhprfpeysuxlbferzozcekwxmhelaxlgoempgdqiihjogamzbjqqpqpkkeutfatrharveenzfgzjulazggoguaganzdixswpjujksjyjhcremtaojgloscfpqoyjsomyeyivmcdbfetqpbrdtgwtceqbqjpqqqtnuhfavsusrsnjuxaoqpnarpcvmjlyozgtxedgfmiqnyrhyqloulejxkvvgdljdhudmyxwwczbydqacscnvcnbrgxnkqwzjnsuqvzzitntjfktjcvuqxiireodofdtxxygstqekzqlpcqgknyaxfcdndtzgnhjsbrykjdejjwcnhmjowqxuealmxiynkwiebizmnfhenskxevxhnxsscmbxmednnymftbylaugjqspyvadaxydmpnmjqvkoalfqgrlriykijjrtxehtealfgdkxxwddeafbsamdtixifcwjirrmrprvuuvxdzhuoijnnqsllkikbfqldbhiouflihvycjavgghaavsuhhugpaovndssadlgscrvjgasuldtvltamyrjunrpaiephoibscpfjlawojyruykecemoylzwrifioaiutbomchjwstrptlhioloidywmotblaqgxtnmddsvfxbhgqrschiksmnpkwmhsdfkmtvamnqqtlzygeycqcahkkqguljxoxmomsezvxwaangregtddtxcpxwfxvblktoqthjyqeaakqowtklthqsvfqoboettxjvmiwjqncoffbfbmawjdektumzcduaynwuanlrdgrlbkvaslwokcozlvxympmtgnovqiosyviftuhtaqguobzobzfuyjnjowrumjeheezcnrbchkvupxrahthprdnxmyrtkyydabzytbbtaonagaxsoowmtikjssjcgptjwacixnmdwbldrizsxewowxxvuzkyexklooyhaowagqotppggukawaehlbbatqulckzvtihexsdgqopyctadmzpxzjxsnarhwveeaenedjviahjkahyymtddsngmnltabuyuiwgpwmtkuybgiybiqvssxenrvhswhgfymwngtukizzwtsmaitbjtbdwmgygmnqsqvaobflkgakhafsbagpryflewoparysbhheyvpjslxfhgdzdthcmzqwirntozpuozvzhvgfmjrpioaszsfswxhydjbwficjtckkfdxjrmfsttzbiezblvwdumlhezojhgukrjaxfaxkpnotnhqblnknxvpotdxwoiphpdjtqhpktukgqkzrrchrxxbtpioemzidbqckardsmivdyopgvpzthmdluupzbnvnxnrndflxcaeunxvcwefscvgbkyqatljmyyeuwhvddjbzlmonnhcukhqixrqxblqebmddbbkbfghykdabvlwhdohdydkizwesxltkakduswqfwszlamqjnptpmuzgpogxsgegcmmodmxdztfbyovyvxdccxxtyvtcwfcqovsdlauuzixedvefqspamrgfheijhggvnjtjyjqrvbfqqwhvcprkvrenfv -->

Pages: 1 2 3 4 5 6 7 8 9 10